KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2460Help
Entry
RSP_2460          CDS       T00284                                 

Gene name
alr
Definition
(RefSeq) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    RSP_2460 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RSP_2460 (alr)
Enzymes [BR:rsp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RSP_2460 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:rsp01011]
 Precursor biosynthesis
  Racemase
   RSP_2460 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(1100940..1101989)
Genome map
AA seq 349 aa AA seqDB search
MATATLTIDLDAIAANWRALDQMTASDCQTGAVVKADSYGLGAAKVAHALARAGARRFFV
ATCEEGADVRRALGSGPQICVFSGHMEGDTALIRDFDLTPMLNSIDQLTRHFEALGGQPF
GLQLDSGMNRLGLEPGEWEAVAGFALEAGPELLMSHLACSDDPDHPMNAEQLGAFRAMTD
GTGVPRSLSATGGILLGPAWHFELTRPGIGLYGGRPFENARPVVRLSLPVIQVREVEIGE
PVGYSNTWTAEHTSTIATVAAGYADGLPRTLSSRATLYAGRVPCPLVGRVSMDLITVDVS
HLPEVPETLDILGPHQTPDDLADTAGTIGYEILTSLGRRYQRRYGALAA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgcgaccctcaccatcgacctggacgccatcgccgccaactggcgcgcgctc
gaccagatgaccgcctccgactgccagaccggcgccgtcgtgaaggctgacagctacggg
ctcggcgcggccaaggtcgcccatgccctcgcgcgggccggtgcccgccgcttcttcgtc
gccacctgcgaggaaggggccgacgtgcgccgcgcgctcggctccgggccgcagatctgc
gtcttctcggggcatatggagggcgacaccgccctcatccgcgatttcgacctgacgccg
atgctgaactcgatcgaccagctcacccggcatttcgaggcgctgggcggccagcccttc
ggcctgcagctcgacagcgggatgaaccggctcgggctcgagcccggcgaatgggaggcc
gtggccggcttcgcgctcgaggcgggaccggaactgctgatgagtcacctcgcctgttcg
gacgatcccgaccatccgatgaatgccgagcagctcggcgccttccgggccatgaccgac
ggcaccggcgtgccgcgctcgctctcggccacgggcggcatcctgctgggccccgcctgg
catttcgagctgacccgccccggcatcggcctctacggcggccgcccgttcgagaatgcg
cgcccggtggtgcggctctcgctgccggtgatccaggtgcgcgaggtcgagatcggcgag
cccgtgggctattccaacacctggacggccgaacatacctcgaccatcgccacggtcgcc
gcgggctatgccgacgggctgccgcgcacgctgtcctcgcgcgccacgctttatgcgggc
cgggtgccctgcccgctggtgggccgggtgtcgatggatctcatcacggtggatgtgagc
cacctgcccgaagtgcccgagacgctcgacatcctcgggccgcaccagacgccggacgat
ctggccgacacggcgggaaccatcggctacgagatcctgacgagcctcggccgccgctac
cagcgccgctacggggccctcgcggcgtga

DBGET integrated database retrieval system