KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_4063Help
Entry
Rsph17025_4063    CDS       T00512                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rsph17025_4063
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rsph17025_4063
Enzymes [BR:rsq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Rsph17025_4063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
pRSPA02:107250..108671
Genome map
AA seq 473 aa AA seqDB search
MAAKTYDAGVKDYRSIYWEPQYQVKDSDILAVFKVVPQPGVSREEAAAAVAAESSTATWT
TVWTDLLTDLDYYKGRAYAIEDVPGSDEAFYAFIAYPMDLFEEGSVVNVFTSLVGNVFGF
KAVRALRLEDVRFPLWFVMTCPGAPHGMKVERDLLDKYGRPLLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFLRWRDRFLFCQEAIEKAEAETGERKGHYMNVTAGTM
EEIYERAEFAKEIGTPIIMSDYLTVGWSAHTSLSRWCRKNGMLLHVHRAMHAVMDRNPNH
GINFRVLAKILRLMGGDHLHSGTVVGKLEGDREATIGWINLLRDRFIKADRSRGIFFDQD
WGPQPGLFPVASGGIHVWHMPALVSIFGNDSVLQFGGGTLGHPWGNAAGACANRFALEAC
VQARNDGRNLEKEGKEILTKAAQTSPELRMAMETWKEVRFEFDTVDKLDVQHR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaagacctatgacgccggagtgaaggactatcgctccatctactgggagccg
cagtatcaggtgaaggacagcgacatcctcgccgtcttcaaggtggtgccgcagcccggc
gtgagccgcgaggaggccgccgccgccgtcgccgccgaaagctcgaccgccacctggacg
acggtctggaccgaccttctgaccgacctcgactattacaagggccgcgcctacgcgatc
gaggacgtgccgggcagcgacgaggccttctacgccttcatcgcctatccgatggacctg
ttcgaggaaggctcggtcgtcaacgtcttcacctcgctcgtcggcaacgtcttcggcttc
aaggcggtgcgcgccctgcggctggaggatgtgcgcttcccgctgtggttcgtgatgacc
tgccccggcgcgccgcacgggatgaaggtcgaacgcgacctgctggacaagtacggccgc
ccgcttctgggctgcacgatcaagccgaagctgggcctgtcggccaagaactacggccgc
gcggtctatgagtgcctgcgcggcggcctcgacttcaccaaggacgacgagaacgtcaac
tcgcagcccttcctgcgctggcgcgaccgcttcctgttctgccaggaggcgatcgagaag
gccgaggccgagaccggcgagcgcaagggccactacatgaacgtgaccgccggcacgatg
gaagagatctacgagcgcgccgagttcgcgaaggagatcggtacgcccatcatcatgtcg
gactatctgacggtgggctggtcggcgcacacgagcctctcgcgctggtgccgcaagaac
gggatgctgctgcatgtccaccgcgcgatgcatgcggtgatggaccgcaacccgaaccac
ggcatcaacttccgggtgctggccaagatccttcggctgatggggggcgatcacctccat
tccggcaccgtcgtcggcaagctggaaggcgaccgggaggccacgatcggctggatcaac
ctgctgcgcgaccgcttcatcaaggccgaccgttcccgcgggatcttcttcgatcaggac
tgggggccgcagcccggcctgttcccggtcgcctcgggcggcatccatgtctggcacatg
ccggcgctggtctcgatcttcggcaatgattcggtactgcagttcggcggcgggacgctc
ggccacccctggggcaacgccgcgggcgcctgcgccaaccggttcgcgctggaagcctgc
gtgcaggcccgcaacgacggccgcaacctcgagaaggagggcaaggagatcctgaccaag
gccgcccagaccagccccgagctgcgcatggcgatggagacctggaaggaagtgcgattc
gagttcgacaccgtcgacaagctcgacgtgcagcaccgctga

DBGET integrated database retrieval system