KEGG   Rhizobium tropici: RTCIAT899_CH00455Help
Entry
RTCIAT899_CH00455 CDS       T02432                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rtr  Rhizobium tropici
Pathway
rtr00250  Alanine, aspartate and glutamate metabolism
rtr00410  beta-Alanine metabolism
rtr00640  Propanoate metabolism
rtr00650  Butanoate metabolism
rtr01100  Metabolic pathways
rtr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RTCIAT899_CH00455 (gabT)
   00650 Butanoate metabolism
    RTCIAT899_CH00455 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RTCIAT899_CH00455 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RTCIAT899_CH00455 (gabT)
Enzymes [BR:rtr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RTCIAT899_CH00455 (gabT)
Amino acid related enzymes [BR:rtr01007]
 Aminotransferase (transaminase)
  Class III
   RTCIAT899_CH00455 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGB69518
UniProt: L0LDR7
LinkDB All DBs
Position
complement(99342..100664)
Genome map
AA seq 440 aa AA seqDB search
MQNFCKIIRKHLVGATAMTLTERKNAAISRGVGMTTQIYADRAENAEIWDKEGHRYIDFA
SGIAVVNTGHRHPRVIAAVKEQLDRFTHTCHQVVPYESYVHLAERLNAIVPGDFAKKTIF
VTTGAEAVENAVKIARAATGRSAIIAFGGGFHGRTFMGMALTGKVAPYKIGFGPMPGDVF
HAPFPVPLHGISVEQSLATLKKLFAADVDPQRVAAIILEPVQGEGGFYPAPAAFMKALRE
ICDQHGILLIADEVQTGFARTGKMFAMDHHEVAADLVTMAKSLAGGFPLAAVTGRAEIMD
APAPGGLGGTYGGNPLGIAAAHAVLDVIADEGLCDRANQLGSRLKQRLESLRDKVPEIVD
IRGPGFMNAVEFNDATTKLPSADFANKVRLIALDKGLILLTCGVYGNVIRFLSPITIQDG
VFSEALDILEASLLEASAAR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaacttctgcaagataattcgaaaacaccttgtgggagccactgcaatgaccttg
accgagcggaagaacgccgccatttcccgcggcgtcggcatgacgacgcagatctatgcc
gaccgtgccgaaaatgcggaaatctgggataaggaagggcatcgctatatcgattttgcc
tccggcattgcggtggtgaatacaggccatcgccatccccgcgtgattgccgccgtcaag
gaacagctcgaccgctttacgcatacctgccatcaggtcgtaccctatgagagctatgtg
catctggccgagcggctgaacgcgatcgttcccggcgatttcgccaagaagacgatcttc
gtgacgacgggtgccgaagcggtcgaaaatgccgtcaagatcgcccgcgccgccaccggc
cgctccgccatcatcgcctttggtggcggcttccacggccgtactttcatgggcatggcg
ctgaccggcaaggtcgcaccctataagataggcttcggcccgatgccgggcgatgttttc
catgcacccttcccggtgccgctgcacggcatcagtgtcgagcagtcgctggcgacactg
aagaagctgtttgccgccgatgtcgatccacagcgtgtggccgcgatcatcctcgagccc
gtgcagggcgaaggcggcttctatccggcgccggcggccttcatgaaggcactgcgcgag
atttgcgaccagcatggcattctcctgatcgccgacgaggtgcagaccggctttgcgcgc
accggcaagatgtttgcgatggaccaccatgaggtggcggccgatctcgtcaccatggca
aagagccttgccggcggctttccgctcgccgccgtcaccggccgagccgaaatcatggat
gcacccgctccaggcggcctcggtggcacctatggcggcaatccgctcggcatcgcggct
gcccatgccgtgctcgacgtcatcgccgacgagggtctgtgcgaccgcgccaatcagctc
ggctcgcgcctgaaacagcgactggaatcgctgcgcgacaaggtacccgaaatcgtcgat
atccgcggccccggcttcatgaatgcggttgaattcaacgacgcgacgacgaagctgccg
agcgcggatttcgccaacaaggtgcggctgatcgcgctcgacaagggcctgatccttttg
acctgcggtgtttacggcaatgtcatccgcttcctatcgccgatcaccattcaggacggc
gtcttcagcgaagcgctcgacattctcgaggcatcgctgctggaggcaagcgccgcccgc
taa

DBGET integrated database retrieval system