KEGG   Rhizobium tropici: RTCIAT899_CH05205Help
Entry
RTCIAT899_CH05205 CDS       T02432                                 

Gene name
sodM
Definition
(GenBank) manganese superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rtr  Rhizobium tropici
Brite
Enzymes [BR:rtr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RTCIAT899_CH05205 (sodM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1066045..1066647
Genome map
AA seq 200 aa AA seqDB search
MAFELPELPYDYDALSPFMSRETLEYHHDKHHKAYVDNGNKLAAEAGLADLSLEEIVKKS
FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFAAAGA
TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGADPILGVDVWEHSYYIDYRNLRPKYLEA
FIDSLINWDYVLERYEAATK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgcctgaacttccttacgattacgacgccctttcgcccttcatgtcg
cgtgagacgctcgaatatcaccacgacaagcaccacaaggcctatgtcgacaacggcaac
aagctcgctgcggaagcaggtcttgccgatctttcgctcgaagaaatcgtgaagaagtcc
ttcggcaccaatgccggcctcttcaacaatgctgcccagcactacaaccacatccatttc
tggaagtggatgaagaagggcggcggcggcaacaagctgccgggcaagctcgaagcagcc
tttgcttccgatctcggcggctacgacaagttcaaggccgatttcgccgctgccggcgcc
acccagttcggctccggctgggcatgggtttccgtcaagaacggtaagctcgaaatctcc
aagaccccgaacggcgaaaacccgctcgttcatggtgccgacccgatcctcggcgtcgac
gtatgggaacattcctactacatcgactaccgcaacctgcgtccgaagtacctcgaagcc
ttcatcgacagcctgatcaactgggactacgtcctggagcgctacgaagccgctacgaag
taa

DBGET integrated database retrieval system