KEGG   Rathayibacter toxicus 70137: TI83_02055Help
Entry
TI83_02055        CDS       T03670                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rtx  Rathayibacter toxicus 70137
Pathway
rtx00010  Glycolysis / Gluconeogenesis
rtx00030  Pentose phosphate pathway
rtx00051  Fructose and mannose metabolism
rtx00052  Galactose metabolism
rtx00680  Methane metabolism
rtx01100  Metabolic pathways
rtx01110  Biosynthesis of secondary metabolites
rtx01120  Microbial metabolism in diverse environments
rtx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rtx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TI83_02055
   00030 Pentose phosphate pathway
    TI83_02055
   00051 Fructose and mannose metabolism
    TI83_02055
   00052 Galactose metabolism
    TI83_02055
  Energy metabolism
   00680 Methane metabolism
    TI83_02055
Enzymes [BR:rtx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TI83_02055
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     TI83_02055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: AJM77078
UniProt: A0A0C5B8I5
LinkDB All DBs
Position
complement(466720..467748)
Genome map
AA seq 342 aa AA seqDB search
MKVGILTSGGDCPGLNAVIRGAVYKGIKVYDQEFVGFRDGWRGVVEGDTFPLERSNIQGI
AKQGGTILGTSRTNPFDGENGGPERIAEMLARNCIDSIIAIGGEGTLAAAKRLTDAGLKI
VGVPKTIDNDLGATDYTFGFDTAVGIATDAMDRLRTTGDSHGRCMVAEVMGRHVGWIALH
SGMAAGAHVILIPEKRTSIEQIVEWVQSAQSRGRAPLVVVAEGFSLDSMGDAHSERGLDA
FGRPRLGGIGEVLAPMIEERTGIETRATTLGHIQRGGTPTAFDRVLATRLGMAAIDSVVA
EHWGRMVALRGTDIYHVDFAEALGTLKTVPDARYEEARILFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttgggatccttacctccggcggcgactgcccagggttgaacgccgttatccga
ggcgccgtctacaagggcatcaaggtatacgaccaggagttcgtgggattccgtgacggg
tggcgaggtgtcgttgagggagacactttcccgcttgagcgttcgaacattcagggcatt
gccaagcagggaggcacgatcctcggcacgagccgcaccaacccgttcgacggtgagaac
ggtggccctgagcggatcgcagagatgttggcgcgcaactgcatcgactccatcatcgcg
atcggaggcgagggcaccctcgccgcggccaagcggcttaccgacgcgggcctcaaaatc
gtcggcgtccccaagacaatcgacaacgacctcggtgccaccgactacacctttggcttt
gacaccgcggtgggcatcgcgactgacgcgatggatcgcctccgcaccaccggcgactcg
cacgggcggtgcatggtcgcggaggtcatggggcgacacgtcggctggatcgccctgcac
tcgggcatggctgccggcgcgcacgtcatcctcatccccgagaaacgcacctcgatcgag
cagatcgtcgagtgggtccagagcgcccagtcacgcggtcgcgcaccgctggtcgtcgtc
gccgagggcttctcgctcgactcgatgggtgatgcgcactccgaacgcggtctcgacgca
ttcggccgcccgcgcctgggcggcatcggtgaggtgctggctccgatgatcgaagagcgc
acgggcatcgaaacccgtgcgacgaccctggggcatatccagcgcggaggcacccccacc
gcgttcgatcgagtgctcgcgacccggctgggcatggccgccatcgactccgtcgtggca
gagcactggggccgcatggtcgcgttgcgcggaaccgatatctaccacgtcgatttcgcg
gaggcgctcggcaccctcaagacggtgccggacgctcgctacgaggaggcgcgcatcctc
ttcgggtag

DBGET integrated database retrieval system