KEGG   Rhodomicrobium vannielii: Rvan_0009Help
Entry
Rvan_0009         CDS       T01353                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00630  Glyoxylate and dicarboxylate metabolism
rva00710  Carbon fixation in photosynthetic organisms
rva01100  Metabolic pathways
rva01120  Microbial metabolism in diverse environments
rva01200  Carbon metabolism
Module
rva_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rva_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rva_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rvan_0009
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rvan_0009
Enzymes [BR:rva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Rvan_0009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small DUF772
Motif
Other DBs
NCBI-ProteinID: ADP69300
JGI: Rvan_0009
UniProt: E3I481
LinkDB All DBs
Position
complement(10695..11117)
Genome map
AA seq 140 aa AA seqDB search
MRITQGQFSFLPDLTDEQIAKQVQYAIEKGWAVNIEFTDDPHPRNSYWEMWGLPMFDIKD
AAAVVSELQACRKVYSGRYYIRISAFDATHGWESLRMSFIVDRPAEEPGFDLERQEVDGR
NIRYTTRPYATVKPSGQRYS
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcacccaaggacagttttccttcctgcccgatctgacggacgagcagatcgcg
aaacaggtgcagtacgccatcgaaaagggctgggccgtgaacatcgagttcaccgacgac
ccgcatccccgcaactcctattgggaaatgtggggcctgccgatgttcgacatcaaggac
gccgcggcggtagtctccgagcttcaggcctgccgcaaggtctatagcgggcgttactac
atccgcatctcggcattcgacgcgacgcatggctgggaatcgctccgcatgtcgttcatc
gtggatcgccccgccgaagagcccggcttcgaccttgagcggcaggaagtcgacggccgc
aatatccgctacaccacgcgcccctacgcgacggtgaagccctcgggccagcgctattcg
taa

DBGET integrated database retrieval system