KEGG   Rhodomicrobium vannielii: Rvan_0009Help
Entry
Rvan_0009         CDS       T01353                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rva  Rhodomicrobium vannielii
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rvan_0009
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rvan_0009
Enzymes [BR:rva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Rvan_0009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(10695..11117)
Genome map
AA seq 140 aa AA seqDB search
MRITQGQFSFLPDLTDEQIAKQVQYAIEKGWAVNIEFTDDPHPRNSYWEMWGLPMFDIKD
AAAVVSELQACRKVYSGRYYIRISAFDATHGWESLRMSFIVDRPAEEPGFDLERQEVDGR
NIRYTTRPYATVKPSGQRYS
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcacccaaggacagttttccttcctgcccgatctgacggacgagcagatcgcg
aaacaggtgcagtacgccatcgaaaagggctgggccgtgaacatcgagttcaccgacgac
ccgcatccccgcaactcctattgggaaatgtggggcctgccgatgttcgacatcaaggac
gccgcggcggtagtctccgagcttcaggcctgccgcaaggtctatagcgggcgttactac
atccgcatctcggcattcgacgcgacgcatggctgggaatcgctccgcatgtcgttcatc
gtggatcgccccgccgaagagcccggcttcgaccttgagcggcaggaagtcgacggccgc
aatatccgctacaccacgcgcccctacgcgacggtgaagccctcgggccagcgctattcg
taa

DBGET integrated database retrieval system