KEGG   Rhodomicrobium vannielii: Rvan_0945Help
Entry
Rvan_0945         CDS       T01353                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rva  Rhodomicrobium vannielii
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rvan_0945
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Rvan_0945
Enzymes [BR:rva01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Rvan_0945
Peptidoglycan biosynthesis and degradation proteins [BR:rva01011]
 Precursor biosynthesis
  Racemase
   Rvan_0945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1051439..1052593
Genome map
AA seq 384 aa AA seqDB search
MDTGFSEAVERALAAAPASANGVLVIRLPALRRNYRRAAEASLKAETAAVVKANAYGLGI
QPVLTALQKETARTFFVATLDEALALRTFANDATIYTLNGLMPGTSAVYRDARLRPVLNS
LAEVEEWSAYCREHEARLPAAIQFDTGMCRVGLEPEAADALAEKPELLQPFRPAVLMSHL
VRADEPMHPLNEVQFKRFEAVTSLFPGIAKSLVNSAGCLLRRKYHLDLARPGIAIYGGNP
QKVEPSQFEPVVWLFGRIVQVRHGEKGFTVGYGGTETLRRDSRIATVGVGYADGYFRGVS
SSDAKPGAVGHIGEHALPLIGRVSMDLTTFDATDVPEALVHRGGFVELLGEKTTVDDLAR
HAGTIGYEVLTSLGRRYHRVYVDE
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacacggggttttcagaggcggtggaacgcgcgctggctgcggctccagcctccgcc
aacggcgtgctggtgatccggcttcccgcgctgcgccgcaactaccggcgcgcggccgag
gcctcgctcaaggcggagacggcggcggtggtgaaggccaacgcgtacggcctcggcatc
cagccggtcctgacggcgctgcaaaaggaaactgcccgcaccttcttcgtcgcgacgctc
gacgaggcgctggcccttcgcacattcgcgaacgacgccacgatctacacgttgaacggg
ctgatgccgggcacctccgccgtctaccgcgacgcgcggctgcgcccggttctgaacagc
ctcgccgaagttgaggagtggtccgcctactgccgcgagcacgaggcgcgcctccccgcc
gcgatccagttcgacaccggcatgtgccgcgtcggcctcgaaccggaagccgccgacgct
ctggcggaaaagccggagctgttgcagccgtttcgcccggccgtgctgatgagccatctc
gtgcgcgcggatgagccgatgcacccgctgaacgaagttcagttcaagcgcttcgaggcg
gtgacgtcgctgtttcccggcatcgcgaagagcctcgtcaattcggcggggtgcctgctt
cgccgcaagtatcacctcgacctcgcgcgccccggcattgcgatttatggcggcaacccg
cagaaggtggagccgtcgcaattcgagccggtcgtctggctgttcggacgcatcgttcag
gtgcggcacggcgagaagggtttcacggtcggttacggcgggacggagacgctgaggcgc
gacagccgcatcgcaaccgttggcgtcggttacgcggacgggtatttcaggggcgtttcg
tcgtcggacgcgaagccgggcgcggtcggccatatcggcgagcacgcgcttccgcttatc
ggccgtgtgtcgatggacctgacgaccttcgacgcgacggatgtgcccgaagcgctcgtt
catcgcggcggcttcgtcgagttgctcggtgagaagaccacggtagacgacctcgcgcgc
cacgctggcaccatcggttacgaagtgctgacatcgctcgggcggcgctatcaccgggtc
tatgtcgatgagtaa

DBGET integrated database retrieval system