KEGG   Rubrobacter xylanophilus: Rxyl_0315Help
Entry
Rxyl_0315         CDS       T00368                                 

Definition
(GenBank) Trehalose synthase-like protein
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rxyl_0315
Enzymes [BR:rxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Rxyl_0315
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Rxyl_0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
333566..336931
Genome map
AA seq 1121 aa AA seqDB search
MTQTARRGAARREEAYREDPLWYKDAIIYQLHVKAFFDSDNDGIGDFRGLTQRLEYIKDL
GVNAIWLMPFYPSPMRDDGYDISEYKNVHPEYGTRRDFRNFVRRAHALGLKVITELVINH
TSDAHPWFQRARKAPRNSVWRNFYVWSDTDKKYADARIIFTDTETSNWTWDPVAQQYYWH
RFFSHQPDLNHDNPRVFDAIMRVMRFWLDAGVDGLRLDAIPYLIEREGTDCENLPETHEI
LRRMRAELDARYQNRIFLAEANQWPEDVLPYFGKGDECHMAFHFPLMPRIYMAVAQEDRH
PIVEIMQQTPEIPEVCQWAIFLRNHDELTLEMVTDRERDYMYQTYAADPRARINLGIRRR
LAPLMENDRARIELLNSLLMSMPGTPIIYYGDEIGMGDNVFLGDRNAVRTPMQWTSDRNA
GFSRADPHSLYLPPIMDPVYGYEALNVEAQSRSPGSLLNWMKRIIAVRKAHKAFGRGTLE
FLHPGNRKVLAYLREYGDETILCVANLSRSAQPVELDLSRFSGRVPVEMIGGSSFPPIGS
LPYFLTLPGHSFYWFNLTTEAEAPSWHQESPRFFEPPVVVLPAGRQTARDIRRLPLRLQH
RQVAQLEQEALPAFLSVRRWFAAKGSEIERVSLLARAEFGPDRLLALLRVGAGGAEHTYF
LPLAAAWEDEDGERVSGLMPHALAKIRRRYRVGVLFDALADEGFCREVVAAMAGGRELEM
GEGRVRFYATGALEELLAGEPVGELAVRRASVEQSNTSVILGERLVLKAYRRLQPGVNPE
LEIGRYLTEVRRFPNTPPLAGAVEYEDPRSGTVSLALLQGFVPSQGDGWSYVLGYLDRYL
ERRLLSASWSPEEEGPAEPPGQEGQEADEGFFMELMRTLGVRTGELHAALAAPTDDPSFS
PEPAPPAEVSRWVEAVLDDLRLTLSLLERRRSGLPEEVRPEVDRLLRMEARAFDRLEAIS
ARGIRAVKTRHHGDYHLGQVLVAGNDFQIIDFEGEPARTLEERRRKHSPLRDVAGMLRSF
DYAAQTALMNLGADRAVGEDPEPVVRRWERSVREAFLGGYAEGVRGAGVLPGEGEEAAAL
VELFALEKALYEIRYELDNRPDWIGIPVRGVLDLLTREESP
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atgacccagacggcccgcaggggggcggcgcgccgggaggaggcctaccgggaggacccg
ctctggtacaaggacgccatcatctaccagctgcacgtaaaggccttcttcgactcggac
aacgacggcatcggggacttcaggggcctgacgcagcggctggagtacataaaagacctc
ggggtcaacgccatctggctcatgcccttctacccctccccgatgcgcgacgacggctac
gacatctccgagtacaagaacgtccaccccgagtacggcacccgccgcgacttccgcaac
ttcgtgcgccgggcgcacgccctgggcctcaaggtcataaccgagctggtcataaaccac
acctccgatgcgcacccctggttccagcgggccagaaaggcgcccaggaactccgtctgg
cgcaacttctacgtctggagcgacaccgacaagaagtacgccgacgcccggatcatcttc
accgacaccgagacctccaactggacctgggacccggtcgcccagcagtactactggcac
cggttcttcagccaccagccggacctcaaccacgacaacccccgggtcttcgacgccatc
atgcgggtgatgcgcttctggctggacgccggggtggacgggctgaggctggacgccatc
ccctacctcatagagcgcgaggggaccgactgcgagaacctcccggagacccacgagatc
ctcaggcggatgagggccgagctggacgcccgctaccagaacaggatcttcctggccgag
gccaaccagtggccggaggacgtgctgccgtacttcgggaagggcgacgagtgccacatg
gccttccacttccccctgatgcccaggatctacatggccgtggcgcaggaggaccggcac
cccatcgtggagatcatgcagcagaccccggagatccccgaggtctgccagtgggccatc
ttcctcagaaaccacgacgagctgacgctggagatggtcaccgaccgcgagcgggactac
atgtaccagacctacgccgccgacccccgcgcccggataaacctgggcatccggcgccgg
ctcgcccccctcatggagaacgaccgggcccgcatagagctgctcaacagcctgctcatg
agcatgcccggcacccccatcatctactacggggacgagatcgggatgggggacaacgtc
ttcctcggggaccgcaacgcggtgcgcacgcccatgcagtggacctccgaccgcaacgcg
ggcttctcccgggccgacccccacagcctctacctgcccccgatcatggacccggtctac
ggctacgaggccctcaacgtggaggcccagagccgcagcccgggctcgctgctgaactgg
atgaagcggatcatcgcggtgcgcaaggcccacaaggccttcgggcgggggacgctggag
ttcttgcaccccggcaaccggaaggtgctggcctatttgcgggagtacggggacgagacg
atcctctgcgtggccaacctctcccgctccgcccagccggtggagctggacctctcccgg
ttcagcgggcgggtgccggtcgagatgatcggggggagcagcttcccgcccatcggctcg
ctgccgtacttcctcaccctccccgggcacagcttctactggttcaacctcaccaccgag
gccgaggccccgagctggcaccaggagagcccccgcttcttcgagccgccggtggtggtg
ctgcccgccggccgccagacggcccgggacatccgccggctgccgctgcgcctgcagcac
cgccaggtggcgcagctggagcaggaggcgctgccggccttcctgagcgtccggcggtgg
ttcgcggcgaagggcagcgagatagagcgggtgagcctcctcgcccgggcggagttcggc
ccggaccgcctgctggcgctgctgcgggtgggggccgggggcgccgaacacacctacttc
ctgccgctcgccgccgcctgggaggacgaggacggcgagcgggtctcgggcctcatgccg
cacgccctggccaagatccggcgccgctaccgggtcggcgtcctcttcgacgcgctcgcg
gacgagggcttctgccgggaggtggtcgccgcgatggccggggggcgggagctggagatg
ggggaggggcgggtgcgcttctacgccaccggcgccctcgaggagctgctggcgggggag
ccggtgggggagctcgcggtccggcgggcctcggtggagcagagcaacacctcggtgatc
ctgggcgagcggctggtgctgaaggcctaccgccggctgcagccgggcgtcaacccggag
ctggagatcgggcgctacctcaccgaggtgcggcgcttcccgaacaccccgccgctcgcg
ggggccgtggagtacgaggacccgcgctcggggacggtctccctggccctcctgcagggc
ttcgtccccagccagggcgacggctggtcctacgtgctgggctacctggaccgctacctg
gagcggcgcctgctctccgcctcctggagcccggaggaggagggcccggcggagcccccc
gggcaggagggtcaggaggccgacgagggctttttcatggagctgatgcggaccctcggg
gtgcgcaccggcgagctgcacgctgccctggccgcccccaccgacgacccctccttctcc
cccgagcccgccccgcccgcggaggtctcccgctgggtcgaggccgtgctggacgacctg
cggctcaccctgagcctcctggagcgccgccggtccgggctgccagaggaggtgcgcccc
gaggtggaccgcctgctccggatggaggcccgggccttcgaccggctggaggcgatctcc
gcccgggggatacgggccgtgaagacccgccaccacggggactaccacctcgggcaggtg
ctcgtcgccgggaacgacttccagatcatagacttcgagggcgagcccgcccgcaccctg
gaggagcgccgccgcaagcactcccctctgcgcgacgtggccggcatgctccgctccttc
gactacgccgcccagaccgccctgatgaacctgggggccgaccgggccgtcggggaggac
ccggagcccgtggtgcgccgctgggagcggagcgtgcgggaggccttcctcgggggctac
gccgagggcgtgcggggcgccggggtcctcccgggggagggcgaggaggccgccgccctc
gtcgagcttttcgccctggagaaggcgctctacgagatccgctacgagctggacaaccgc
ccggactggatcgggataccggtccggggcgtcctggaccttctgacgagggaggagagc
ccgtga

DBGET integrated database retrieval system