KEGG   Singulisphaera acidiphila: Sinac_2800Help
Entry
Sinac_2800        CDS       T02393                                 

Definition
(GenBank) BNR/Asp-box repeat protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
saci  Singulisphaera acidiphila
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Sinac_2800
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sinac_2800
Enzymes [BR:saci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Sinac_2800
Bacterial toxins [BR:saci02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Sinac_2800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3503073..3504305
Genome map
AA seq 410 aa AA seqDB search
MIKKRVEAMRKRLGRRSLAITFLTAWLIGDLGMSQAVLSAQLPSSKESGGKPAAKSQREG
LMQLDVFVAGQDGYKSFRIPSLLVTPHGTVLAFCEGRKHSGGDSGDIDLVQRKSTDGGTT
WGPLQVIADDGPHTMGNPCPVVDRETGTIWMLMTRNHGQDKESQILNGTSQETRSVWVMK
STDEGLTWSPRVEITPQVKLPDWTWYATGPGVSIQLESGRMVVPCDHFLAKSKVSRSHVI
YSDDHGATWKIGGVGGERVNECQVAELSNRTLLLNMRHQPPRRGEGRAISTSRDGGLTWT
PPTLDPSLVEPACQASLIGLKDEQGRASNRLLFSNPASSKRELMTVRLSEDGGKTWSQHK
SLHAGPSAYSCLANLAGRNIGCLYERGERGPYERITLARFDLDWLTSHPE
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaaagggttgaagcgatgcgaaaacgtctggggcgtcggtctctcgcgatc
acgttcttgaccgcctggctcattggcgatttggggatgagccaggccgtcctgtcggcg
cagttaccgtcgtcgaaggaatcgggcggcaaaccagcggccaagagccaacgcgaaggg
ctcatgcaactcgacgttttcgtggctgggcaagacggatacaagtcgttccgcattccc
tctctgctggtcaccccgcacggaactgtgcttgccttctgtgaagggcgaaaacactcg
ggcggagacagtggcgatatcgacctggtgcagcgcaaaagcaccgacggcgggaccacc
tggggtcccttgcaggtgatcgccgacgacggcccgcacaccatggggaacccgtgcccg
gtcgtcgaccgcgagaccgggacgatctggatgctcatgacccgcaaccacgggcaagac
aaggaatcccagatcctcaacgggacgagccaggaaacgcggtcagtctgggtgatgaag
agcaccgacgaggggctcacctggtcgcctcgagtggagatcaccccgcaggtcaaactc
cccgattggacctggtacgcgaccggccccggtgtctccatccagctcgagagtgggcgc
atggtggtcccctgcgaccatttcctcgccaagagcaaggtcagtcgctcgcacgtgatt
tacagtgacgaccatggggcaacctggaaaatcggcggggtcgggggtgagcgagtcaac
gagtgccaggtcgccgagctcagcaatcggaccctcttgctgaacatgcgacatcaacca
ccaagacggggagaaggccgagcgatctcgaccagtcgggatggcggtttgacctggacg
ccccccacccttgatcccagcttggtcgaacccgcttgccaggccagcctgatcggcctc
aaggacgagcaggggcgggcgtcgaatcggctgctcttttccaatccggccagctccaag
cgggaattgatgacggtgcgactcagtgaagatggaggaaagacctggtcgcaacacaag
tcccttcacgcaggtccctcggcctactcatgcctggccaacctggccggacggaatatc
ggctgcctctatgagcgaggcgaacgcggaccgtacgagcggatcacgctcgctcggttc
gacctcgactggttgacttcccatcccgagtga

DBGET integrated database retrieval system