KEGG   Stenotrophomonas acidaminiphila: AOT14_17700Help
Entry
AOT14_17700       CDS       T04107                                 

Definition
(GenBank) DNA ligase family protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sacz  Stenotrophomonas acidaminiphila
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sacz00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AOT14_17700
Enzymes [BR:sacz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AOT14_17700
DNA repair and recombination proteins [BR:sacz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AOT14_17700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1947913..1950072
Genome map
AA seq 719 aa AA seqDB search
MARGHLRFQLFGGKLRGGWHLVRSGARGRQPEWLLFKARDAYAAPLEADDLLDAAPPGRG
PAAGTRPRPVPVRGRRLLAAAAKLPGARRTRAEPAFHAPQLATLVEAVPDGDGWLHEAKW
DGYRLIAQLARDRVRLWSRNALEWTQRLPAIVQALQALDVVAVLDGELVAGAGRQQDFGL
LQASLSGERAAPLSYVLFDILQLGDIDVRGCRQDDRKALLATLLESASPPLVYSSHVADG
QRALAMAVERGLEGIISKRAAAAYRSGRGDHWRKVKHLMSDEFVVVGFTAPKGSRSGLGA
LLLATPVGRRGWRYAGRVGSGFNQYTLDALVRRLSPLARDTPVPAITAGAVGPCRVQWVK
PVMVVEVFHHGTGNHGLLRQASFKTIRADRNVAELRAAAPVPVPEEHSMPDHMPGSSAAA
TDVALTSPSRVVYPDAGIRKQEVFAYYRDMLPWLLPEVVGRPVSVVRCPQGTQRPCFFQK
HLPPGTGHVGTVPIEEEGGTRADYIVVRDAAGLLELVQFNALEFHPWGARADAPDLADRI
VFDLDPGPGVAWARVVAAARQVRDHLRELGLESFVRTSGGKGLHVVVPLRPACEWSQVKA
FARAFAEAMATADPLAYVATASKRQRKGRIFIDYLRNGRGATSVASFSLRARPGAPVAMP
LRWEELGRVRRADAYDIASAPRRMKRMKQHPWGDIDRIRQDLAPIAARLAGRNPRRPDS
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
ttggccagggggcacctgcgcttccagctgttcggcggcaagctcaggggcggatggcac
ctggtgcgttcgggtgcacgtgggcggcagccggaatggttgttgttcaaggcgcgcgac
gcatacgcggccccactggaggcggacgacctgctggacgctgccccgcccgggcggggg
ccggccgcgggcacgcgaccacgccccgtgccggtgcggggccggcgcctgttggcagcc
gcggccaaactgcccggtgcccgccgcacccgcgcagaacctgcattccacgcgccgcag
ctggccaccctggtggaggcggtgccggacggggacggctggctgcacgaagccaaatgg
gatggctatcggctgatcgcgcagctggcccgcgaccgggtgcggctgtggtcgcgcaac
gcgctggaatggacgcagcggctgcccgcgatcgtgcaggccctgcaggcgctcgatgtc
gtggcggtgctggacggcgagctggtggccggggccggacgccagcaggatttcggcctg
ctgcaggccagcttgtcgggtgagcgcgccgcgcccctgtcctatgtgctgttcgacatc
ctgcaactgggcgatatcgatgtccgtggctgccgccaggacgaccgcaaggcgttgctg
gccacgctgctggagtcggcatcgccgccgctggtgtacagctcgcacgtggccgatggc
cagcgcgccctggccatggcggtggaacgcggactggagggcatcatctccaagcgtgcc
gcggcggcttaccgcagcggtcgcggcgaccactggcgcaaggtcaagcacctcatgtcc
gacgagttcgtggtggttgggttcaccgcacccaagggcagccgcagtgggctgggggcg
ctgctgctggccacgcccgtgggccgcaggggctggcgctatgccggccgggtgggaagc
ggtttcaaccagtacacgctcgacgcactggtgcggcggctgtcgccgctcgcccgcgac
accccggtaccggccatcaccgccggggccgtcgggccgtgcagggtgcaatgggtgaag
ccggtcatggtggtggaagtgttccatcatggcaccggcaatcacggcctgctgcggcag
gcgtcgttcaagaccatccgcgccgaccggaacgtggccgagctgcgcgccgcggcgccg
gttccagtaccggaggaacacagcatgcctgaccatatgcccgggtcgtcagctgccgcc
accgatgtggcgctgaccagccccagccgcgtggtgtatccagacgccggcatccgcaag
caggaagtgttcgcctactaccgcgacatgctgccgtggctgctgccggaggtcgtcggc
aggccggtgtcggtggtgcgctgtccgcagggcacccagcgaccgtgtttcttccagaaa
cacctgccgcccggcaccgggcatgtcggcacggtgccgatcgaggaggagggcggcacc
cgcgcggactacatcgtggtgcgcgatgcggccgggctgctcgagctggtgcagttcaat
gcgctggagttccatccgtggggcgcgcgggccgacgcgccggacctcgctgaccgcatc
gtgttcgatctcgatcctggcccgggggtggcctgggcccgggtggtggcagcggcccgg
caggtgcgcgatcacctgcgcgaactgggcctggaatccttcgtgcgcacctccggcggc
aagggcctgcacgtggtggtgccgctgcggccggcctgcgagtggtcgcaggtgaaggcc
ttcgcgcgtgctttcgccgaagccatggcgactgccgatccgttggcctacgtggccacg
gccagcaagcgccagcgcaaggggcgcatcttcatcgactacctgcgtaacggccggggt
gccaccagcgtggcgtcgttctcgttgcgggcccggccgggcgcgccggtggccatgcca
ttgcgctgggaggagctgggcagggtccggcgcgcagacgcctacgacatcgcctcggca
ccacgccggatgaagcggatgaagcagcatccctggggcgacatcgaccggatccggcag
gacctggcgcccattgccgcgcgcctggccgggcgcaacccacgcagaccagattcatga

DBGET integrated database retrieval system