KEGG   Simiduia agarivorans: M5M_17395Help
Entry
M5M_17395         CDS       T02281                                 

Definition
(GenBank) dipeptidyl carboxydipeptidase family protein
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
saga  Simiduia agarivorans
Brite
Enzymes [BR:saga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     M5M_17395
Peptidases [BR:saga01002]
 Metallo Peptidases
  Family M2
   M5M_17395
Exosome [BR:saga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M5M_17395
CD molecules [BR:saga04090]
 Proteins
  M5M_17395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3830997..3832841
Genome map
AA seq 614 aa AA seqDB search
MRTPHKLSVLALAVATGLLVGCQPEGKEKATVAQAEAAKVYDQAAADAFLEEAEAALKDT
AEYASRASWLAATYINGDSQFVEARASKEYTLQVVKYAMQVKNWDGAQVDPVTRRKLDAL
RLGLSFPSPADEKLAGELADIGSKMQGMYGAGKYCRESGECLDLIQMSNILAEGKDPALM
MEVWTGWRSVSPPMRPLYQRQVEIANAGAQDLGFENLSVLWRSNYDMAPDAFAADVDKQW
GKVKPLYDALHCHVRAKLNEAYGDDVVPATGKIPAHMLGNMWAQTWGNVYDKVKPANSQK
SYDLTKLIEKSGMNEIGMVRTAEAFFSSLGFAPLPDSFWETSQFVKPRDRDVVCHASAWN
MDSKDDLRIKMCIQKNGEDFQTVHHELGHNYYQRAYNQQPFLFQGSANDGFHEALGDTVA
LSITPSYLVSLGMLKEEPPVSEDLGYLMQMALDKIAFLPFGLLVDKWRWQVFNGEIKPED
YNKGWWSLREQYQGITPPVARSEADFDPGAKYHIPGNTPYTRYFLAFIQQFQFHRSLCET
AGYEGPLHRCSIYNNKAAGDKLQAMMAMGTSQPWQNAMQALTGQPELDASAIVDYFAPLK
VWLDEQNKDRQCGW
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacaccccataaactttcagtgttggcgctggcagtggcgaccggcctgctggtg
ggttgccagcccgaaggcaaagaaaaggccacggttgcccaggcagaagcggctaaagtg
tacgatcaggcagcggcggacgcgtttttagaagaagccgaagccgcgttgaaagacacc
gcagaatacgcgtcccgcgccagctggttagcggccacctacatcaacggcgacagtcag
tttgtagaggcccgcgcgtctaaggaatacaccttgcaggtggtgaagtatgccatgcag
gtaaaaaactgggacggtgcccaggtggatccggtcacccgccgcaagctggatgccttg
cgtctgggcctgagcttcccatcgccggcggatgagaagctggccggtgagctcgcggat
attggctccaaaatgcaggggatgtacggcgcgggcaaatactgccgcgaatccggcgag
tgtctggacctgattcagatgagtaacattctggccgaaggtaaagacccggcgctgatg
atggaggtctggaccggttggcgcagtgtatcgccacctatgcggcccctgtatcagcgc
caggtggaaattgccaatgccggcgcccaggacctgggctttgaaaatctctcggtgctg
tggcgctccaactacgacatggcgcccgatgcctttgccgccgatgtagacaagcaatgg
ggcaaggtcaaacccttgtacgatgccctgcattgccatgtgcgcgcaaaactgaatgaa
gcctacggcgatgacgtggtgcccgccaccggtaagattccggcgcatatgctgggcaat
atgtgggcccagacctggggcaatgtgtacgacaaggtcaaacccgccaatagccagaaa
agctacgatctgaccaaattgattgaaaaaagtggcatgaatgaaatcggcatggtacgt
acggccgaggcgtttttctcttcattgggctttgcaccgctgccggacagtttctgggaa
acctcgcaatttgtgaaaccgcgtgaccgcgacgtggtgtgtcatgccagcgcctggaat
atggacagcaaagacgacctgcgcatcaaaatgtgcatccagaaaaacggcgaagatttt
cagacagtgcaccacgagctgggccacaactactaccagcgcgcttacaaccagcagccg
ttcctgttccagggcagtgccaacgacggcttccacgaagcgctgggcgataccgtcgcg
ctttcgattacgccctcttatctggtgagcctgggcatgctgaaggaagagccgccggtc
tccgaagatctgggctacctgatgcagatggcgctcgataaaatcgcctttttgccgttt
ggtttgttggtggacaagtggcgttggcaggtattcaacggtgaaatcaaacccgaagat
tacaacaagggctggtggtcgctgcgcgaacaataccagggcatcacaccgccggtggcg
cgctccgaggctgatttcgatccgggtgccaagtaccacattccgggtaatacgccttac
acccgttacttcctggcctttatccagcaattccagttccaccgttcactgtgtgaaacc
gccggctacgaaggcccgctgcatcgctgttccatctacaacaacaaagccgccggcgac
aagctccaggccatgatggccatgggcaccagccagccctggcagaacgccatgcaggcg
ctcaccggacagcccgaactggatgccagtgcgatcgtggattattttgcgccactgaag
gtgtggctggatgaacagaacaaagaccgtcaatgcggttggtga

DBGET integrated database retrieval system