KEGG   Streptococcus agalactiae NGBS572: EN73_05570Help
Entry
EN73_05570        CDS       T03517                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sagg  Streptococcus agalactiae NGBS572
Pathway
sagg00240  Pyrimidine metabolism
sagg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EN73_05570
Enzymes [BR:sagg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     EN73_05570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_22 AAA_30 ATPase_2
Motif
Other DBs
NCBI-ProteinID: AIF88656
UniProt: R4Z8S1
LinkDB All DBs
Position
complement(1063132..1063701)
Genome map
AA seq 189 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDEFGVVSSRIGMRREAV
PISDDMDIFSYIQNLPQKPYCVLIDECQFLSKKNVYDLARVVDDLDVPVMAFGLKNDFQN
NLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVC
RKHYFNPDI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaactctattataaatatgggacaatgaattctggtaaaaccattgaaatttta
aaagttgctcataactatgaagaacaaggaaaacctgtggttattatgacaagcgccttg
gacactcgagatgaatttggagtcgtttcaagtcgtattggaatgcgtcgtgaagcagtt
ccaatttcagatgatatggacattttctcctatattcagaatttaccacaaaagccttat
tgtgttttaattgatgaatgtcaatttttgagtaagaaaaacgtctacgatttagctaga
gtagtagatgacttagatgtaccagtcatggcttttggtttgaaaaatgatttccaaaac
aatctttttgaaggttcaaaacatttgctattattggccgataagattgatgaaatcaaa
acaatttgccaatactgtagtaagaaagcaaccatggttttaaggacagaaaacggaaaa
cctgtctatgaaggtgatcagatacaaattggtggtaatgaaacatatatcccagtttgt
cgaaaacattattttaatccagatatttaa

DBGET integrated database retrieval system