KEGG   Streptococcus agalactiae 09mas018883: BSA_19490Help
Entry
BSA_19490         CDS       T02703                                 

Definition
(GenBank) Sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sagm  Streptococcus agalactiae 09mas018883
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:sagm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BSA_19490
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BSA_19490
Enzymes [BR:sagm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BSA_19490
Bacterial toxins [BR:sagm02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BSA_19490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1913497..1915947)
Genome map
AA seq 816 aa AA seqDB search
MTLTFGKPSITIRRLGVITSIYMMLGFILLCGLLHPSTIYSEEIKSDINSFISIDDEKTT
APIFDSTLDKLTNSIEERQLELDSDTSDGLIVDDQKDKDMVVVLGDSDSQEKLSPPLKSE
IATEENRKQANLAELNATQPNNRTTYIIPESSHSIAEQQRFLIESKGSSVALLNSDEFRK
TAREDRGFERDKLRSLDIIPKGDLSTSNVIGNTDIASQISLGFKKNAIQEHHLTKTFSQK
DGKLSSVIEGMLAIGKEKVEKEIKYSGNLWQKLKAKAHCLVCCVDNLNFEDIKSYFQYYC
HLNHQLKLPKGAILSAKTEVYRGGDFGRKNKDNVFGYRIPSLLKTEKGTLLAGADERIEQ
ACDWGNIGMVIRRSEDDGVTWGKRETIVNLRNNPRVPLVTSGDYSGSPINMDMALVQDTS
SKTKRIFSIYDMFPEGRGVISIANTPEKEYTQIGGQSYLNLYNNEKKSKVFTIRDKGIVY
NFKGKKTDYHVITETTKSDHSNLGDIYKGKQLLGNIYFTKHKTSPFRLAKSSYVWMSYSD
DDGRTWSSPRDITASLRRRGMKFLGIGPGKGIVLKWGPHAGRIIIPAYSTNWKSHLRGSQ
SSRLIYSDDHGKTWHTGKAVNDNRVLSNGEKIHSLTMDNKKEQNTESVPVQLKNGDIKLF
MRNLTGNLEVATSKDGGETWQNHVKRYKEVHDAYVQLSAIRFEHDKKEYILLVNANGPGK
KRQDGYARLAQVNRNGSFKWLYHHHIQDGSFAYNSVQQLNNDQFGVLYEHREKHQNSFTL
NYKVFNWSFLSQNTEKQGTLWEKMAANWHVLFKFYL
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgacattaacctttgggaaaccttctataacgatacgccgtctaggagtgataactagt
atatatatgatgctaggttttatcttattatgtggacttttgcatcctagtacaatttat
agtgaggaaataaaatctgatataaactcttttatatcaatagatgatgaaaaaactact
gctcccatatttgactctactttagataagcttactaattcaatagaggagaggcagtta
gaattagattctgatacatcggacggtttaatagtagatgatcaaaaagataaagatatg
gtagtagtcttaggtgattctgacagtcaagaaaaattgtcacctcctctaaaatcggaa
atagcgacagaagaaaatcgtaaacaggcaaatttagcagaactaaatgcaactcaacct
aataatagaactacctatattatacccgaaagcagtcattccattgcagaacaacagaga
ttcctgatagaatcaaagggttcttcggttgcattacttaatagcgatgaatttagaaag
acagcgagagaggatagaggttttgaaagggataagttgaggtctttggatatcattcct
aagggagatttatcgacaagtaatgtcataggtaatacggacattgctagtcagatatcg
ttgggctttaaaaagaatgcgatacaggaacaccatcttactaaaacattctctcaaaag
gatggaaagttatcgtctgttatagaggggatgcttgctattggcaaagagaaagtagag
aaagaaataaaatatagtggtaatttatggcaaaaattaaaagctaaggcacactgcctt
gtttgctgtgttgataatttgaattttgaagatataaaatcttattttcaatattattgt
catctaaaccatcagctcaaattacctaaaggtgctatactttctgctaaaacagaagta
tataggggaggagattttgggagaaaaaataaagataatgtgtttggttaccgtatcccc
tcattattgaaaaccgaaaaaggaactttacttgcaggagctgatgaaagaattgagcaa
gcttgtgattggggaaacataggaatggttattcgccgtagtgaggatgatggtgtcact
tggggaaaaagagaaactattgtcaatctccgtaataaccctagagttccgctagttact
agtggtgactatagtggctcacctattaatatggatatggcattagttcaagatactagc
tctaagacgaaacgtattttttcaatatatgatatgtttccagaaggaagaggcgttatt
agtattgctaacacacctgaaaaagaatatacccaaatcggaggacagtcttatcttaat
ttatataataatgaaaagaaatcgaaggtttttactatccgtgacaaaggtattgtatat
aattttaaagggaaaaagactgattatcatgttataacagaaactactaaaagtgaccat
tcaaatctaggggatatttataagggaaaacagctacttggaaatatatattttacaaaa
cataaaacgtcaccatttcgtttagcaaaatcaagctatgtgtggatgtcatatagcgat
gatgatggtaggacatggtcatcacctagagatataacagcaagtcttcgtcggagaggc
atgaaatttttgggaataggacctggaaaaggtatagttttaaaatgggggccacacgct
ggtcgtattattattcctgcctattctacgaattggaaatctcatctaagaggttcacaa
tcttcacgcctaatttattcagacgaccatggaaaaacgtggcatactggaaaagcagtc
aatgataaccgtgtactttctaatggtgaaaaaattcactcattaacaatggataataaa
aaagaacaaaatacagaatccgtacctgttcaattgaaaaatggggacattaagttattt
atgaggaatctaactggtaacctagaagtagccacaagtaaagacggcggggagacttgg
caaaaccatgttaaacgatataaggaagttcatgatgcttacgtccaactatcagctatt
cgctttgagcatgacaaaaaagagtatattttattagtgaatgctaatgggccaggtaag
aagcgtcaagatggatatgcacgtctagcgcaagttaatcgaaatggtagttttaagtgg
ttatatcaccatcacattcaagatggttcgtttgcttacaactctgttcaacaacttaat
aatgatcaatttggtgtcctttatgaacatagagaaaaacatcaaaatagttttacttta
aattacaaagtttttaattggagttttcttagtcaaaatacagagaagcaaggcacttta
tgggagaaaatggcagcaaattggcatgttttgtttaaattttatttatga

DBGET integrated database retrieval system