KEGG   Streptococcus agalactiae CNCTC 10/84: W903_1868Help
Entry
W903_1868         CDS       T03518                                 

Definition
(GenBank) BNR repeat-like domain protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sagn  Streptococcus agalactiae CNCTC 10/84
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sagn00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    W903_1868
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    W903_1868
Enzymes [BR:sagn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     W903_1868
Bacterial toxins [BR:sagn02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   W903_1868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1803301..1805751)
Genome map
AA seq 816 aa AA seqDB search
MTLTFGKPSITIRRLGVITSTYMMLGFILLCGLLHPSTIYSEEIKSDINSFISIDDEKTT
APIFDSTLDKLTNSIEERQLELDSDTSDGLIVDDQKDKDMVIVLGDSDSQEKLSPPLKSE
IATEENRKQANLAELNVTQLDNRTTYIIPESSHSIAEQQRFLIESKGSSVALLNSNEFRK
TAGEDRGFERDKLRSLDIIPKGDLSTSNVIGNTDIASQISLGFKKNAMQEHHLTKTFPQK
DGKLSSVIEGMLAIGKEKVEKEIKYSGNLWQKLKAKAHCLVCCVDNLNFENIKSYFQYYC
HLNHQLKLPKGAILSTKTEVYRGGDFGRKNKDNVFGYRIPSLLKTEKGTLLAGADERIEQ
ACDWGNIGMVIRRSEDDGVTWGKRETIVNLRNNPRVPLVTSGDYSGSPINMDMALVQDTS
SKTKRIFSIYDMFPEGRGVISIANTPEKEYTQIGGQSYLNLYNNGKKSKVFTIRDKGIVY
NFKGKKTDYHVITETTKSDHSNLGDIYKGKQLLGNIYFTKHKTSPFRLAKSSYVWMSYSD
DDGRTWSSPRDITASLRRRGMKFLGIGPGKGIVLKWGPHAGRIIIPTYSTNWKSHLRGSQ
SSRLIYSDDHGKTWHTGKAVNDNRVLSNGEKIHSLTMDNKKEQNTESVPVQLKNGDIKLF
MRNLTGNLEVATSKDGGESWQNHVKRYKEVHDAYVQLSAIRFEHDKKEYILLVNANGPGK
KRQDGYARLAQVNRNGSFKWLYHHHIQDGSFAYNSVQQLNNDKFGVLYEHREKHQNSFTL
NYKVFNWSFLSQNTEKQGTLWEKMAANWHVLFKFYL
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgacattaacctttgggaaaccttctataacgatacgccgtctaggagtgataactagt
acatatatgatgctaggttttatcttattatgtggacttttgcatcctagtacaatttat
agtgaggaaataaaatctgatataaactcttttatatcaatagatgatgaaaaaactact
gctcccatatttgactctactttagataagcttactaattcaatagaggagaggcagtta
gaattagattctgatacatcggacggtttaatagtagatgatcaaaaagataaagatatg
gtaatagtcttaggtgattctgacagtcaagaaaaattgtcacctcctctaaaatcggaa
atagcgacagaagaaaatcgtaaacaggcaaatttagcagaactaaatgtaactcaactt
gataatagaactacctatattatacccgaaagcagtcattccatcgcagaacaacagaga
ttcctgatagaatcaaagggttcttcggttgcattacttaatagcaatgaatttagaaag
acagcgggagaggatagaggttttgaaagggataagttgaggtctttggatatcattcct
aagggagatttatcgacaagtaatgtcataggtaatacggacattgctagtcagatatcg
ttgggctttaaaaagaatgcgatgcaggaacaccatcttactaaaacattccctcaaaag
gatggaaagttatcgtctgttatagaggggatgcttgctattggcaaagagaaagtagag
aaggaaataaaatatagtggtaatttatggcaaaaattaaaagctaaggcacactgcctt
gtttgctgtgttgataatttgaattttgaaaatataaaatcttattttcaatattattgt
catctaaaccatcagctcaaattacctaaaggtgctatactttctactaaaacagaagta
tataggggaggagattttgggagaaaaaataaagataatgtgtttggttaccgtatcccc
tcattattgaaaaccgaaaaaggaactttacttgcgggagctgatgaaagaattgagcaa
gcttgtgattggggaaacataggaatggttattcgccgtagtgaggatgatggtgtcact
tggggaaaaagagaaactattgtcaatctccgtaataaccctagagttccgctagttact
agtggtgactatagtggctcacctattaatatggatatggcattagttcaagatactagc
tctaagacgaaacgtattttttcaatatatgatatgtttccagaaggaagaggcgttatt
agtattgctaacacacctgaaaaagaatatacccaaatcggaggacagtcttatcttaat
ttatataataatggaaagaaatcgaaggtttttactatccgtgacaaaggtattgtatat
aattttaaagggaaaaagactgattatcatgttataacagaaactactaaaagtgaccat
tcaaatctaggggatatttataagggaaaacagctacttggaaatatatattttacaaaa
cataaaacgtcaccatttcgtttagcaaaatcaagctatgtgtggatgtcatatagcgat
gatgatggtaggacatggtcatcacctagagatataacagcaagtcttcgtcggagaggc
atgaaatttttgggaataggacctggaaaaggtatagttttaaaatgggggccacacgct
ggtcgtattattattcctacctattctacgaattggaaatctcatctaagaggttcacaa
tcttcacgcctaatttattcagacgaccatggaaaaacgtggcatactggaaaagcagtc
aatgataaccgtgtactttctaatggtgaaaaaattcactccttaacaatggataataaa
aaagaacaaaatacagaatccgtacccgttcaattgaaaaatggggacattaagttattt
atgaggaatctaactggtaacctagaagtagccacaagtaaagacggcggggagagttgg
caaaaccatgttaaacgatataaggaagttcatgatgcttacgtccaactatcagctatt
cgctttgagcatgacaaaaaagagtatattttattagtgaatgccaatgggccaggtaag
aagcgccaagatggatatgcacgtctagcgcaagttaatcgaaatggtagttttaagtgg
ttatatcaccatcacattcaagatggttcgtttgcttacaactctgttcaacaacttaat
aatgataaatttggtgtcctttatgaacatagagaaaaacatcaaaatagttttacttta
aattacaaagtttttaattggagttttcttagtcaaaatacagagaagcaaggcacttta
tgggagaaaatggcagcaaattggcatgttttgtttaaattttatttatga

DBGET integrated database retrieval system