KEGG   Streptococcus agalactiae ILRI112: SAIL_9060Help
Entry
SAIL_9060         CDS       T02705                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sagr  Streptococcus agalactiae ILRI112
Brite
Translation factors [BR:sagr03012]
 Eukaryotic Type
  Elongation factors
   SAIL_9060
 Prokaryotic Type
   SAIL_9060
Mitochondrial biogenesis [BR:sagr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SAIL_9060
Exosome [BR:sagr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SAIL_9060
  Exosomal proteins of breast cancer cells
   SAIL_9060
  Exosomal proteins of colorectal cancer cells
   SAIL_9060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CCW41923
LinkDB All DBs
Position
810454..811650
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPTSVNQPKDYASIDAAPEER
ERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDEKYEDIIMELMSTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTV
RVNDEVEIVGIKEDIQKAVVTGVEMFRKQLDEGLAGDNVGVLLRGVQRDEIERGQVLAKP
GSINPHTKFKGEVYILSKEEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTIEVELIHPIAVEQGTTFSIREGGRTVGSGIVSEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccacacgttaacattggtacaatcggacac
gttgaccacggtaaaactactttaacagcagctatcacaactgtattggcacgtcgcttg
cctacttcagttaaccaaccaaaagattacgcttctatcgatgctgctccagaagagcgc
gaacgcggaatcacaatcaacactgcacacgttgagtacgaaactgaaaaacgtcactat
gcccacatcgacgctccaggacacgcggactacgttaaaaacatgatcactggtgctgct
caaatggacggagctatccttgtagttgcttcaactgatggaccaatgccacaaactcgt
gagcacatccttctttcacgtcaagttggtgttaaacaccttatcgtattcatgaacaaa
gttgaccttgttgatgatgaagaattgcttgaactggttgaaatggaaattcgtgacctt
ctttcagaatacgacttcccaggtgatgaccttccagttatccaaggttcagctcttaaa
gcacttgaaggcgatgaaaaatacgaagacatcatcatggaattgatgagcactgttgat
gagtacattccagaaccagaacgtgatactgacaaacctttacttcttccagtcgaagat
gtattctcaatcactggacgtggtacagttgcttcaggacgtatcgaccgtggtactgtt
cgtgtcaacgacgaagttgaaatcgttggtattaaagaagatatccaaaaagcagttgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgcaggggacaacgttggt
gttcttcttcgtggtgttcaacgtgatgaaatcgaacgtggtcaagttcttgctaaacca
ggttcaatcaacccacacactaaatttaaaggtgaagtttacatcctttctaaagaagaa
ggtggacgtcatactccattcttcaacaactaccgtccacaattctacttccgtacaact
gacgtaacaggttcaatcgaacttccagcaggaacagaaatggttatgcctggtgataac
gttactatcgaagttgaattgattcacccaatcgccgtagaacaaggtactactttctca
atccgtgaaggtggacgtactgttggttcaggtatcgtttcagaaatcgaagcttaa

DBGET integrated database retrieval system