KEGG   Streptococcus agalactiae SA20-06: SaSA20_1397Help
Entry
SaSA20_1397       CDS       T02338                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
sags00473  D-Alanine metabolism
sags01100  Metabolic pathways
sags01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SaSA20_1397 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SaSA20_1397 (alr)
Enzymes [BR:sags01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SaSA20_1397 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:sags01011]
 Precursor biosynthesis
  Racemase
   SaSA20_1397 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TIG
Motif
Other DBs
NCBI-ProteinID: AFV72840
UniProt: A0A2I6W466
LinkDB All DBs
Position
complement(1454520..1455620)
Genome map
AA seq 366 aa AA seqDB search
MISSYHRPTRALIDLEAIANNVKSVQEHIPSDKKTFAVVKANAYGHGAVEVSKYIESVVD
GFCVSNLDEAIELRQAGIVKMILVLGVVMPEQVILAKNENITLTVASLEWLRLCQTSAVD
LSGLEVHIKVDSGMGRIGVRQLDEGNKLISELGESGASVKGVFTHFATADEADNCKFNQQ
LTFFKDFISGLDNCPDLVHASNSATSLWHSETIFNAVRLGVVMYGLNPSGTDLDLPYPIK
PALSLESELVHVKQLHDGSQVGYGATYQVTGDEFVGTVPIGYADGWTRDMQGFSVIVNGE
LCEIIGRVSMDQMTIRLPQKYTIGTKVTLIGQQGSCNITTTDVAQKRQTINYEVLCLLSD
RIPRYY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagttatcatagaccaactagagccttgatagatttagaggcgattgcaaat
aacgttaaatctgtacaagagcacattccaagtgataaaaaaacatttgctgtagttaag
gctaatgcttatgggcatggtgctgttgaagtttcaaaatacattgagtctgttgtagat
ggtttttgcgtatccaatttagatgaggctattgagctacgtcaagcaggaattgtaaaa
atgatattggtattaggtgttgttatgcctgagcaggttatactagccaaaaatgaaaat
attactctaacagttgctagcttggagtggttacgtttatgtcagacatcagcagtagat
ttatctggtctagaagtacatatcaaagttgatagtggaatgggacgtataggtgttcgc
cagttagatgaaggaaataagctaatttctgaattgggggaaagtggtgcctctgtcaag
ggggttttcacccattttgcaacagctgatgaagccgataactgtaaattcaatcaacaa
cttactttttttaaagactttatttcaggattagataattgtccggaccttgttcatgct
agtaattctgctacaagcctttggcatagtgagacaatttttaatgccgttagattgggt
gttgttatgtacggcttaaatccaagtgggactgatttagatttaccttaccctataaaa
cctgctttaagtttagagtctgagctagtacatgttaaacaactacacgatggttctcaa
gttggctatggcgcaacctatcaagttactggagacgaatttgttggaacagtaccgatt
ggctacgctgatggatggacacgagatatgcaaggattttcagtcatagtaaatggagaa
ctttgtgaaattattgggcgtgtctcgatggatcaaatgactatccgtttacctcaaaaa
tatactattggaactaaagtaaccttgattggtcaacaaggtagttgtaacattacaact
acggacgtcgctcaaaaaagacagacgattaattatgaagtactttgtcttttaagcgat
cgtattccgagatattattaa

DBGET integrated database retrieval system