KEGG   Streptococcus agalactiae COH1: GBSCOH1_1727Help
Entry
GBSCOH1_1727      CDS       T03434                                 

Definition
(GenBank) neuraminidase-related protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sagt  Streptococcus agalactiae COH1
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:sagt00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    GBSCOH1_1727
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GBSCOH1_1727
Enzymes [BR:sagt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     GBSCOH1_1727
Bacterial toxins [BR:sagt02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   GBSCOH1_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1800400..1802850)
Genome map
AA seq 816 aa AA seqDB search
MTLTFGKPSITIRRLGVITSTYMMLGFILLCGLLHPSTIYSEEIKSDINSFISIDDEKTT
APIFDSTLDKLTNSTEERQLELDSDTSDGLIVDDQKDKDMVVVLGDSDSQEKLSPPLKSE
IATEENRKQANLAELNATQPNNRTTYIIPESSHSIAEQQRFLIESKGSSVALLNSDEFRK
TAGEDRGFERDKLRSLDIIPKGDLSTSNVIGNTDIASQISLGFKKNAMQEHHLTKTFSQK
DGKLSSVIEGMLAIGKEKVEKEIKYSGNLWQKLKAKAHCLVCCVDNLNFEDIKSYFQYYC
HLNHQLKLPKGAILSAKTEVYRGGDFGRKNKDNVFGYRIPSLLKTQKGTLLAGADERIEQ
ACDWGNIGMVIRRSEDDGVTWGKRETIVNLRNNPRVPLVTSGDYSGSPINMDMALVQDTS
SKTKRIFSIYDMFPEGRGVISIANTPEKEYTQIGGQSYLNLYNNGKKSKVFTIRDKGIVY
NFKGKKTDYHVITETTKSDHSNLGDIYKGKQLLGNIYFTKHKTSPFRLAKSSYVWMSYSD
DDGRTWSSPRDITASLRQKGMKFLGIGPGKGIVLKWGPHAGRIIIPAYSTNWKSHLRGSQ
SSRLIYSDDHGKTWHTGKAVNDNRILSNGEKIHSLTMDNKKEQNTESVPVQLKNGDIKLF
MRNLTGNLEVATSKDGGETWQNHVKRYKEIHDAYVQLSAIRFEHDKKEYILLVNANGPGK
KCQDGYARLAQVNRNGSFKWLYHHHIQDGSFAYNSVQQLNNDQFGVLYEHREKHQNSFTL
NYKVFNWSFLSQNTEKQGTLWEKMAANWHVLFKFYL
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgacattaacctttgggaaaccttctataacgatacgccgtctaggagtgataactagt
acatatatgatgctaggttttatcttattatgtggacttttgcatcctagtacaatttat
agtgaggaaataaaatctgatataaactcttttatatcaatagatgatgaaaaaactact
gctcccatatttgactctactttagataagcttactaattcaacagaggagaggcagtta
gaattagattctgatacatcggacggtttaatagtagatgatcaaaaagataaagatatg
gtagtagtcttaggtgattctgacagtcaagaaaaattgtcacctcctctaaaatcggaa
atagcgacagaagaaaatcgtaaacaggcaaatttagcagaactaaatgcaactcaacct
aataatagaactacctatattatacccgaaagcagtcattccattgcagaacaacagaga
ttcctgatagaatcaaagggttcttcggttgcattacttaatagcgatgaatttagaaag
acagcgggagaggatagaggttttgaaagggataagttgaggtctttggatatcattcct
aagggagatttatcgacaagtaatgtcataggtaatacggacattgctagtcagatatcg
ttgggctttaaaaagaatgcgatgcaggaacaccatcttactaaaacattctctcaaaag
gatggaaagttatcgtctgttatagaggggatgcttgctattggcaaagagaaagtagag
aaagaaataaaatatagtggtaatttatggcaaaaattaaaagctaaggcacactgcctt
gtttgctgtgttgataatttgaattttgaagatataaaatcttattttcaatattattgt
catctaaaccatcagctcaaattacctaaaggtgctatactttctgctaaaacagaagta
tataggggaggagattttgggagaaaaaataaagataatgtgtttggttaccgtatcccc
tcattattgaaaacccaaaaaggaactttacttgcgggagctgatgaaagaattgagcaa
gcttgtgattggggaaacataggaatggttattcgccgtagtgaggatgatggtgtcact
tggggaaaaagagaaactattgtcaatctccgtaataaccctagagttccgctagttact
agtggtgactatagtggctcacctattaatatggatatggcattagttcaagatactagc
tccaagacgaaacgtattttttcaatatatgatatgtttccagaaggaagaggcgttatt
agtattgctaacacacctgaaaaagaatatacccaaatcggaggacagtcttatcttaat
ttatataataatggaaagaaatcgaaggtttttactatccgtgacaaaggtattgtatat
aattttaaagggaaaaagactgattatcatgttataacagaaactactaaaagtgaccat
tcaaatctaggggatatttataagggaaaacagctacttggaaatatatattttacaaaa
cataaaacgtcaccatttcgtttagcaaaatcaagctatgtgtggatgtcatatagcgat
gatgatggtaggacatggtcatcacctagagatataacagcaagtcttcgtcagaaaggc
atgaaatttttgggaataggacctggaaaaggtatagttttaaaatgggggccacacgct
ggtcgtattattattcctgcctattctacgaattggaaatctcatctaagaggttcacaa
tcttcacgcctaatttattcagacgaccatggaaaaacgtggcatactggaaaagcagtt
aatgataaccgtatactttctaatggtgaaaaaattcactccttaacaatggataataaa
aaagaacaaaatacagaatccgtacccgttcaattgaaaaatggggacattaagttattt
atgaggaatctaactggtaacctagaagtagccacaagtaaagacggcggggagacttgg
caaaaccatgttaaacgatataaggaaattcatgatgcttacgtccaactatcagctatt
cgctttgagcatgacaaaaaagagtatattttattagtgaatgctaatgggccagggaag
aagtgccaagatggatatgcacgtctagcgcaagttaatcgaaatggtagttttaagtgg
ttatatcaccatcacattcaagatggttcgtttgcttacaactctgttcaacaacttaat
aatgatcaatttggtgtcctttatgaacatagagaaaaacatcaaaatagttttacttta
aattacaaagtttttaattggagttttcttagtcaaaatacagagaagcaaggcacttta
tgggagaaaatggcagcaaattggcatgttttgtttaaattttatttatga

DBGET integrated database retrieval system