KEGG   Streptomyces albus J1074: XNR_2513Help
Entry
XNR_2513          CDS       T02545                                 

Definition
(GenBank) Aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
salb  Streptomyces albus J1074
Pathway
salb00220  Arginine biosynthesis
salb00250  Alanine, aspartate and glutamate metabolism
salb00290  Valine, leucine and isoleucine biosynthesis
salb01100  Metabolic pathways
salb01110  Biosynthesis of secondary metabolites
salb01130  Biosynthesis of antibiotics
salb01210  2-Oxocarboxylic acid metabolism
salb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XNR_2513
   00290 Valine, leucine and isoleucine biosynthesis
    XNR_2513
   00220 Arginine biosynthesis
    XNR_2513
Enzymes [BR:salb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     XNR_2513
    2.6.1.66  valine---pyruvate transaminase
     XNR_2513
Amino acid related enzymes [BR:salb01007]
 Aminotransferase (transaminase)
  Class I
   XNR_2513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGI88884
UniProt: D6AYG7
LinkDB All DBs
Position
complement(2890574..2891785)
Genome map
AA seq 403 aa AA seqDB search
MMFRQSGKLKDVCYEIRGPVVDQANALEEAGHSVLRLNTGNPAPFGFEVPEEILQDIIRN
LPNAHGYSDARGIMPARRAVVQYYQQCGVAGVTVDDVYLGNGASELIQMAVQALVDDGDE
VLVPAPDFPLWTAVVRLAGGRVTHYLCDEEADWFPDLDDIAAKITDRTKAIVVINPNNPT
GAVYSKELLEGILDLARRHGLMVLADEIYDKILYDDAEHHCLAALSDDVVTLTFNGLSKA
YRVAGFRSGWLAVSGPKEQARDYLEGLSMLAGMRLCPNVPAQYAIQAALGGHQSIAELTL
PTGRLTEQRDVAHRALNEIPGVSCVKPKGALYAFAKLDPDVHKIVDDERFVLDLLLREKI
HVVQGTGFNWPRPDHFRFVTLPRADDLEVAINRIGRFLAGYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttcgacagtccggcaagttgaaggacgtgtgctacgagatcagggggccggtg
gtcgaccaggccaacgccctggaggaggccgggcacagcgtgctgcggctgaacaccggc
aaccccgcgccgttcggcttcgaggtgccggaggagatcctccaggacatcatccgcaac
ctgccgaacgcccacggctacagcgacgcgcggggcatcatgcccgcccggcgcgcggtg
gtgcagtactaccagcagtgcggcgtcgccggcgtcaccgtcgacgacgtctacctcggc
aacggcgcctccgagctgatccagatggcggtccaggcgctggtggacgacggcgacgaa
gtcctcgtgcccgcccccgacttcccgctctggacggccgtggtccggctggccggcggc
cgcgtcacgcactacctgtgcgacgaggaggcggactggttccccgacctcgacgacatc
gccgcgaagatcaccgaccgcaccaaggccatcgtcgtcatcaacccgaacaacccgacc
ggcgcggtctactccaaggagctgctggagggcatcctcgacctcgcccgccggcacggc
ctgatggtcctggcggacgagatctacgacaagatcctctacgacgacgccgagcaccac
tgcctcgccgccctcagcgacgacgtggtcaccctcaccttcaacggcctctccaaggcg
taccgcgtcgccggcttccgcagcggctggctcgcggtctccggcccgaaggagcaggcc
agggactatctggagggcctgtccatgctggccggcatgcggctgtgcccgaacgtgccc
gcgcagtacgccatccaggccgcgctgggcgggcaccagtcgatcgccgaactcaccctg
ccgaccggcaggctcaccgagcagcgcgacgtcgcccaccgggcgctcaacgagatcccg
ggcgtcagctgcgtcaagccgaagggcgccctgtacgccttcgccaagctcgacccggac
gtgcacaagatcgtcgacgacgagcggttcgtcctcgacctgctgctgcgcgagaagatc
cacgtcgtccagggcacgggcttcaactggccccgccccgaccacttccgcttcgtcacc
ctgccccgcgccgacgacctggaggtcgccatcaaccgcatcggccgcttcctcgcgggc
taccgccagtag

DBGET integrated database retrieval system