KEGG   Streptomyces albulus ZPM: SAZ_19960Help
Entry
SAZ_19960         CDS       T03896                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sall  Streptomyces albulus ZPM
Pathway
sall00564  Glycerophospholipid metabolism
sall01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sall00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SAZ_19960
Enzymes [BR:sall01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SAZ_19960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: AKA04474
LinkDB All DBs
Position
complement(4585594..4587303)
Genome map
AA seq 569 aa AA seqDB search
MKTATLGPAQRAKALTQMAERELDVLVVGAGVVGAGTALDAATRGLDTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLQRLAPHLVKPVPFLYPLQHKGWERWY
AGSGVALYDAMSVSSGHGRGLPVHRHLSHRRALRVAPCLRKDALVGALQYYDAQMDDARY
VTTLVRTAAAYGAHVANRARVVGFLREGERVVGARVQDVEGGVAHEIRARQVVNATGVWT
DDTQALIGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLATPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHALDARVAECVTEDVPLAGAEGYRAL
WNARARIAARTGLHVARIEHLLNRYGSLAEELLELVVADPALGRPLAGADDYLRAEVVYA
CTHEGARHLDDVLTRRTRISIETFDRGTRSAREAAELMAPALGWDSAQVDKEVAHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPLT
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacagcgacactcggaccggcgcagcgcgccaaggcactcacccagatggcggag
cgggaactggacgtgctggtggtcggcgccggcgtggtcggcgccggtaccgccctggac
gccgccacccgcgggctggacaccgggctggtcgaggcccgtgactgggcgtcgggtacc
tccagccggtcgagcaagctcatccacggcggcctgcgctacctggagatgctggacttc
gcgctggtgcgggaggcgttgaaggagcgcgggctgctgctccagcggctggcgccccac
ctggtcaaaccggtcccgttcctctacccgctccagcacaagggctgggagcgctggtac
gccggctccggcgtggcgctctacgacgcgatgtcggtgtcgtccggccacggccggggg
ctgcccgtccaccgccacctctcgcaccgccgggcgctgcgtgtggcgccctgtctgcgc
aaggacgcgctggtcggggcgttgcagtactacgacgcgcagatggacgacgcgcgctac
gtcaccaccctggtgcggaccgccgccgcctacggggcgcacgtcgccaaccgggcgcgg
gtggtgggcttcctgcgcgagggcgagcgggtggtcggcgcgcgggtgcaggacgtcgag
ggcggggtggcgcacgagatccgggcccggcaggtcgtcaacgcgacgggcgtgtggacc
gacgacacccaggcgctgatcggggagcgcggccagttccacgtgcgggcgtccaagggc
atccacctggtcgtgcccaaggaccggatccactccaccaccgggctgatcctgcggacg
gagaagagcgtgctcttcgtcatcccgtgggggcggcactggatcatcggcaccacggac
accgactgggacctggacaaggcgcacccggcggcctccagcgccgacatcgactacctg
ctggagcacgtgaactcggtgctggccacgccgctcacccgggacgacgtggagggcgtc
tacgccgggctgcggccgctgctggccggcgagtcggacgccaccagcaagctgtcgcgg
gagcacaccgtcgcccacccggtgccgggcctggtggtcgtcgcgggcggcaagtacacg
acgtaccgggtgatggccaaggacgcggtggacgaggcggtgcacgcactcgacgcgcgg
gtcgccgagtgcgtcaccgaggacgtgccgttggccggcgccgagggctaccgggcgctg
tggaacgcgcgggcccggatcgccgcccggaccggactgcacgtggcccggatagagcac
ctgctgaaccgttacggatcgctggccgaggagctgttggagctggtggtggccgacccc
gcgctcgggcggccgctcgccggggccgacgactacctgcgcgccgaggtggtctacgcg
tgcacgcacgagggcgcccggcacctcgacgacgtgttgacccggcgcacccggatctcc
atcgagaccttcgaccgcggcacccgcagcgcccgggaggcggccgagctgatggcgccg
gccctgggctgggacagcgcgcaggtcgacaaggaggtcgcgcattacgagaagcgggtg
gaggcggagcgcgaatcgcagcggcagcccgacgacctgacggccgatgcggcccggctg
ggcgcgccggacatcgtgccgctgacgtag

DBGET integrated database retrieval system