KEGG   Streptomyces albus DSM 41398: SLNWT_1589Help
Entry
SLNWT_1589        CDS       T03823                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
sals  Streptomyces albus DSM 41398
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sals00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SLNWT_1589
   00650 Butanoate metabolism
    SLNWT_1589
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SLNWT_1589
   00280 Valine, leucine and isoleucine degradation
    SLNWT_1589
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLNWT_1589
Enzymes [BR:sals01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SLNWT_1589
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SLNWT_1589
Amino acid related enzymes [BR:sals01007]
 Aminotransferase (transaminase)
  Class III
   SLNWT_1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2068864..2070198
Genome map
AA seq 444 aa AA seqDB search
MTAVPQERRLVTAIPGPKSQELQARRSAAVAAGVGSVLPVFAARAAGGIVEDVDGNRLID
FGSGIAVTSVGSSAEAVVRRASAQLSDFTHTCFMVTPYEGYVAVAEALAEVTPGDHAKKS
ALFNSGAEAVENAVKIARSYTKRQAVVVFDHGYHGRTNLTMALTAKNMPYKNGFGPFAPE
IYRVPVAYGYRWPTGPESCGPEAAAQAVDQISKQIGAENVAALVIEPVLGEGGFIEPAKG
FLPALRKFATENGIVFVADEIQSGFCRTGQWFACEDEGIVPDLITTAKGIAGGLPLAAVT
GRAEIMDAAHSGGLGGTYGGNPVACAGALGAIETMREQDLAARARRIEEVMKGRLAAMQE
KFEIIGDVRGRGAMLAVELVEDREGKEPNAAATAALAKACHNAGLLVLTCGTYGNVLRFL
PPLVIGEDLLNEGLDILEEAFTQL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagtcccgcaggagcgccgcctcgtcaccgccatccccggtcccaagtcgcag
gaactccaggcccggcgcagtgccgcggtcgccgcgggcgtgggctcggtgctgcccgtg
ttcgccgcccgggccgcgggcggcatcgtcgaggacgtggacggcaaccgcctcatcgac
ttcggctccggcatcgccgtcacctcggtgggctccagcgccgaggccgtggtccgccgc
gcctccgcgcagctcagcgacttcacccacacgtgtttcatggtcacgccctacgagggg
tacgtggccgtcgccgaggccctcgcggaggtgaccccgggcgaccacgccaagaagtcg
gccctgttcaactccggcgccgaggccgtcgagaacgccgtcaagatcgcccgctcgtac
accaagcggcaggccgtcgtcgtcttcgaccacggctaccacggccggaccaacctcacg
atggcgctgaccgcgaagaacatgccgtacaagaacggcttcggccccttcgccccggag
atctaccgggtgccggtggcctacggctaccgctggccgaccggtccggagagctgcggg
ccggaggcggccgcgcaggccgtcgaccagatcagcaagcagatcggcgcggagaacgtc
gccgcgctcgtcatcgagccggtgctcggcgagggcggcttcatcgagcccgcgaagggc
ttcctgcccgcgctgcggaagttcgccacggagaacggcatcgtcttcgtcgccgacgag
atccagtccggtttctgccgtaccggccagtggttcgcctgcgaggacgagggcatcgtg
cccgacctgatcaccaccgccaagggcatcgcgggcggactgccgctcgccgcggtgacc
ggccgcgccgagatcatggacgccgcgcactccggcggcctcggcggcacctacggcggc
aacccggtggcctgcgccggtgcgctcggcgccatcgagaccatgagggagcaggacctc
gccgcccgggcccgccggatcgaggaggtcatgaagggccgtctggcggccatgcaggag
aagttcgagatcatcggcgacgtacgcggccggggcgcgatgctcgccgtcgagctggtc
gaggaccgcgagggcaaggagccgaacgccgccgcgacggccgcgctcgccaaggcctgc
cacaacgccggactcctcgtgctgacctgcggcacctacggcaacgtgctgcgcttcctg
cccccgctggtgatcggcgaggacctgctcaacgagggcctggacatcctcgaagaggcg
ttcacacagctctga

DBGET integrated database retrieval system