KEGG   Streptomyces albus DSM 41398: SLNWT_6831Help
Entry
SLNWT_6831        CDS       T03823                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals00020  Citrate cycle (TCA cycle)
sals00480  Glutathione metabolism
sals01100  Metabolic pathways
sals01110  Biosynthesis of secondary metabolites
sals01120  Microbial metabolism in diverse environments
sals01130  Biosynthesis of antibiotics
sals01200  Carbon metabolism
sals01210  2-Oxocarboxylic acid metabolism
sals01230  Biosynthesis of amino acids
Module
sals_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sals_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sals00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLNWT_6831
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SLNWT_6831
Enzymes [BR:sals01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SLNWT_6831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AJE87207
UniProt: A0A0B5F9R0
LinkDB All DBs
Position
7820566..7822785
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVIEAYASTAGVRVESRDISLAGRIIASFPERLQESQ
RIDDALAELGELAKTPGANIIKLPNISASIPQLKAAVAELQKQGYALPDYPDDPKTDEER
DIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWSPESKTNVTTMGTDD
FRSTEKSVVIAEDGALRIELAGDDGSTTVLREAVPVLAGEVVDASVMRVAALREFLTEQV
ARAKAEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFAEYGKVLAEAGLTPNDGLGGI
LKGVESLPEGAAIKASFEAELAEGPELAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGEEADTLAVLPDSSYAGIYQAVIEDCRAHGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEVPVTGTVRVLDGAGKAVLEQTVSAGDIFRMCQTKDAPIKDWVKLAVTRARATGD
PAVFWLDEGRAHDANLIAKVRQYLPEHDTAGLQIEIKSPVDAITFSLDRIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEHLAQTTGNARAQVLADTLDRATATFLNEDKSPSRKLGGIDNRGSHFY
LALYWAQELAKQTEDAKLAEAFAPLAKTLAEQEQTIVDELLAVQGSPADIGGYYQPETAK
AAAVMRPSATLNQALATLA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacgcacactgacgaggccccggccctggcgacgtat
tcgttcctgccggtgatcgaggcgtacgcctccacggcaggagtgcgcgtggagagccgt
gacatctctctggcggggcggatcatcgccagtttcccggagcggctccaggagagccag
cggatcgacgacgccctcgccgagctgggcgagctggcgaagacgccgggcgcgaacatc
atcaagctgccgaacatctcggcctcgatcccgcagctgaaggccgccgtcgccgagctg
cagaagcagggctacgcgctgccggactacccggacgacccgaagaccgacgaggagcgg
gacatccgcgcccgctacgacaaggtcaagggcagcgccgtcaacccggtcctgcgcgag
ggcaactcggaccgccgggcccccgcctcggtcaagaactacgccaaggcgcacccgcac
cgcatgggcgcctggagccccgagtcgaagaccaacgtcaccaccatgggcaccgacgac
ttccgcagcaccgagaagtccgtggtcatcgccgaggacggcgccctgcgcatcgagctg
gccggggacgacggctccaccaccgtgctgcgcgaggcggtaccggtactcgccggcgag
gtcgtggacgcctccgtgatgcgggtggccgcgctgcgcgagttcctcaccgagcaggtc
gcccgggccaaggcggagggcgtgctcttctccgtccacctgaaggccaccatgatgaag
gtctccgacccgatcatcttcggccacgtggtgcgcgccttcttcccgaagaccttcgcc
gagtacggcaaggtcctcgccgaggcgggcctgacccccaacgacggtctgggcggcatc
ctcaagggcgtcgagtcgctgcccgagggcgcggcgatcaaggcctccttcgaggccgag
ctggccgagggccccgagctggccatggtcgactccgaccgcggtatcaccaacctgcac
gtgccgagcgatgtcatcgtcgacgcctccatgccggccatgatccgcacctccggccac
atgtggggcccggacggcgaggaggcggacaccctcgcggtgctgcccgacagcagctac
gcgggcatctaccaggccgtgatcgaggactgccgcgcgcacggcgcctacgacccctcc
accatgggctcggtcccgaacgtcggcctgatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgaggtgccggtcaccggcaccgtgcgggtcctcgacggcgcgggc
aaggcggtcctggagcagacggtcagcgccggggacatcttccggatgtgccagaccaag
gacgcgcccatcaaggactgggtcaagctcgcggtcacccgcgcccgcgccaccggcgac
ccggccgtgttctggctcgacgagggccgcgcccacgacgccaacctcatcgcgaaggtg
cggcagtacctgccggagcacgacacggcgggcctgcagatcgagatcaagtccccggtg
gacgcgatcaccttctccctggaccgcatccgccgcggcgagaacaccatctcggtcacc
ggcaacgtcctgcgcgactacctcaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctctcggtggtcccgctcatgaacggcggcggcctcttcgagacgggcgcc
ggcggctccgcgcccaagcacgtccagcagctggtgaaggagaactacctgcgctgggac
agcctcggtgagttcctcgccctcgcggtgagcttcgagcacctcgcgcagaccaccggc
aacgcccgcgcccaggtcctcgccgacaccctggaccgcgccacggcgaccttcctcaac
gaggacaagtccccgagccgcaagctgggcggcatcgacaaccgcggcagccacttctac
ctggcgctctactgggcccaggagctggccaagcagaccgaggacgccaagctcgccgag
gccttcgccccgctcgccaagaccctcgccgagcaggagcagaccatcgtcgacgaactc
ctcgcggtgcagggctccccggccgacatcggcggctactaccagcccgagacggccaag
gccgcggcggtcatgcgcccctccgcgaccctcaaccaggcgctggccaccctcgcctga

DBGET integrated database retrieval system