KEGG   Salegentibacter sp. T436: AO058_12985Help
Entry
AO058_12985       CDS       T04614                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
salt  Salegentibacter sp. T436
Pathway
salt00620  Pyruvate metabolism
salt00680  Methane metabolism
salt01100  Metabolic pathways
salt01120  Microbial metabolism in diverse environments
salt01200  Carbon metabolism
Module
salt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:salt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AO058_12985
  Energy metabolism
   00680 Methane metabolism
    AO058_12985
Enzymes [BR:salt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AO058_12985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 LuxQ-periplasm
Motif
Other DBs
NCBI-ProteinID: APS39737
UniProt: A0A1L6R5C5
LinkDB All DBs
Position
complement(2977670..2980243)
Genome map
AA seq 857 aa AA seqDB search
MHREPKLERFNESVLSKYQVYNSIFLTLPFDDISKTGSLLPLFQEICEAGFKENKNPSEI
IESFFSKYQDDPSEEHQISLLFRFIQYIERQVVLFDAIEDASFPIVNNMDGRGTLRNVKE
EAEAKDKTPELREYLKRFNVRPTLTAHPTQFYPGAVLGIITDLDKAIQKNDITLIKKLLA
QLGKTPFFKKEKPTPYDEAVSLIWYFENVFYQSVSKIYNYIQQNIFDGEDIGNQVINLGF
WPGGDRDGNPFVTTEITLKVAQRLRSTILMNYYRDIRKLKRRVTFSEVDAIISEIETPLY
QSAISKTGKIKMSLEDFKSKLHKIKDIVENKHQGLFVEEIDDLINKANIFGYHFATLDIR
QDSGKHAEVLEEIIKTQPNLLPKNYASLSNEEQIEALTKVEGNIDLESYEDGITKSTLSS
IYAMQEIQSKNGENGANRYIISHSEVPQSILEPFAFLRMCGWNKPTVDIIPLFETVPDLK
ASPDVMETLYNNPVYREHLKSRGNKQTIMLGFSDGTKDGGYLMANWSIYKAKEMLTEVSR
RYDIKVVFFDGRGGPPARGGGKTHQFYASLGSGIENEEIQLTVQGQTISSNFGTRDSCRY
NLEQLLSSGVSNEIFSKGKNQLTDEDRETMTHLAEISYETYTNFKQHEKFIPYLEKMSTL
KYYSKTNIGSRPSKRNKDAKLNLNDLRAIPFVGSWSQLKQNVPGFFGVGTALEKFEQAGE
FDKVQQLYKNSVFFKTLLENSMMSLTKSFFTLTAYMEQDKEFGDFWKIIYAEYKRTHAML
LKVTGYDELMENQPAGRASIQARERIVLPLLTIQQHALRKVQELQEQGESAGKMLEVYEK
MVTRSLYGNINASRNSA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgcacagagaaccaaaactagaacgttttaatgaaagcgtactttcaaaatatcaggtt
tataacagtatatttttaacgctgccttttgacgatattagtaaaacaggatcgctgctg
cctctttttcaggaaatttgtgaagcaggctttaaggaaaacaaaaacccttcagaaatt
attgaaagcttcttcagtaaatatcaggatgatccttcagaagaacatcaaatcagttta
cttttcaggtttattcaatatatagaaagacaggtagtgctttttgatgctattgaagat
gcatcttttcctatagtaaacaatatggatggccgcggaacccttagaaatgtaaaagag
gaagccgaagctaaagacaaaacaccggagctgcgggaatatttgaagcgttttaatgta
aggccaactttaactgcccacccaacacaattttatccgggagccgttttaggaataatc
accgatttggataaagctattcagaaaaatgatattacacttattaaaaaattactggct
caacttggcaaaaccccgtttttcaaaaaagagaagccaactccttacgatgaagctgta
agtttgatctggtattttgagaatgttttctaccaaagtgtaagtaagatttataattat
attcagcagaatatttttgatggtgaagatattggtaaccaggtaatcaatttgggattt
tggcccggtggagaccgtgatggtaacccatttgtaactactgaaattactttaaaagta
gcacaaaggttaagaagtactattttgatgaactattaccgcgacattagaaaactgaag
agaagggtaacctttagcgaagtagacgcgattatttctgaaatagaaactccgctatat
caaagtgcaatatccaagaccggaaagattaaaatgtcacttgaagacttcaagtctaaa
ttgcataaaatcaaagatatagttgaaaataaacaccagggattatttgttgaagagatt
gatgatcttattaacaaagcaaatatctttgggtatcattttgctactttagatatacgc
caggattctgggaaacacgctgaagttttagaggaaattattaaaacccagccaaattta
ttgcctaaaaactatgcttcgctttctaacgaagaacaaatagaagcgcttacaaaggtt
gaaggtaatatagatcttgaaagttatgaagacggtatcaccaaatctacactttcctca
atatatgcaatgcaggaaattcagagtaaaaatggagaaaatggggctaatagatatata
attagccacagtgaagtaccgcaaagtattttagagccttttgcatttttgagaatgtgc
ggctggaataaaccaactgtagatattattcctctttttgaaactgtaccagatttaaaa
gcttctccagatgtaatggagactttatataacaatccagtttaccgtgagcatttaaaa
agtagaggaaacaagcaaaccataatgcttggttttagtgacggtactaaagatggtggt
tatttaatggccaactggagtatttataaagccaaggaaatgctaaccgaggtttccagg
agatatgacataaaagttgtattctttgatggtagaggaggaccaccggcacgtggtggt
ggaaaaacccaccaattctatgcatctcttggttctggaattgaaaatgaagaaatccag
ttaactgtacaggggcaaaccattagttctaattttggaactcgtgattcttgtagatat
aatctggaacaactgcttagttctggggtttctaacgaaatatttagcaaaggaaaaaat
cagttaaccgatgaagatcgggaaacaatgacgcatcttgctgagataagttacgaaacc
tacaccaattttaaacaacacgaaaagtttatcccgtatttggaaaaaatgagtacttta
aaatattactcaaaaaccaatattggtagtagaccatctaaaagaaataaggatgctaaa
cttaacctgaacgatctaagagccatcccatttgtaggaagctggagtcaattaaaacaa
aatgttccgggattctttggggtaggtacagctttagagaagtttgagcaagctggcgag
tttgacaaagttcagcagctttataaaaattcggtattctttaaaaccttattggagaat
tctatgatgagtcttaccaagtctttctttacgctaaccgcttatatggagcaggataag
gaattcggagatttttggaagattatttatgctgaatataagcgtacccacgccatgctt
ttaaaagtaactggatatgatgagcttatggaaaatcagccggccggtagagcgtcaatt
caggcacgtgaaagaattgttttgccattgctaaccattcagcaacacgcgcttagaaaa
gttcaggaacttcaggaacaaggcgaaagtgccggtaaaatgcttgaagtttatgagaaa
atggtaacgcgttccctttacggaaatattaacgcaagtagaaattctgcttaa

DBGET integrated database retrieval system