KEGG   Salegentibacter sp. T436: AO058_14905Help
Entry
AO058_14905       CDS       T04614                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
salt  Salegentibacter sp. T436
Brite
Enzymes [BR:salt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AO058_14905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5 DUF3139
Motif
Other DBs
NCBI-ProteinID: APS40086
UniProt: A0A1L6R6C3
LinkDB All DBs
Position
3386618..3387214
Genome map
AA seq 198 aa AA seqDB search
MKRISLSLVFCASLFIIGCKNDKKDNDAENAAETEMNSEMEAQQDEEEVKEITVPLEPKS
GSNLGGEVTFTQENGEVTMEATITGLAEGQHAIHIHQKADCSAEDGTSAGGHWNPTNEKH
GKWGDAEGYHKGDIGNFEVDANGEGTVSMTTDEWCIDCDDENKNIVGKAIIVHDGVDDFT
SQPSGAAGTRVGCGVIKM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataagtttatcattagtattttgcgcctctttatttataattggctgtaaa
aacgacaaaaaagacaatgacgctgaaaacgctgccgaaacagaaatgaattctgaaatg
gaagcacagcaagacgaggaagaagttaaagaaataactgtacctctagagcctaaaagc
ggaagcaacttaggtggtgaagtaacttttacccaggaaaatggagaagttactatggaa
gctaccatcacaggtttagccgagggtcaacacgcgatccatattcaccagaaagcagac
tgctctgctgaagatggaacttctgccgggggccactggaacccaaccaacgaaaaacat
ggtaagtggggtgatgctgaaggctaccacaaaggcgatataggcaactttgaagttgat
gccaatggagaaggtactgtgagcatgactacagatgaatggtgtatagattgtgacgat
gaaaacaagaatattgttggaaaagcaataatagttcacgacggagttgatgatttcacc
tctcaaccttctggagctgcaggcaccagagttggatgtggagtaataaaaatgtaa

DBGET integrated database retrieval system