KEGG   Streptomyces ambofaciens: SAM23877_6536Help
Entry
SAM23877_6536     CDS       T04055                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00020  Citrate cycle (TCA cycle)
samb00480  Glutathione metabolism
samb01100  Metabolic pathways
samb01110  Biosynthesis of secondary metabolites
samb01120  Microbial metabolism in diverse environments
samb01130  Biosynthesis of antibiotics
samb01200  Carbon metabolism
samb01210  2-Oxocarboxylic acid metabolism
samb01230  Biosynthesis of amino acids
Module
samb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
samb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:samb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAM23877_6536 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SAM23877_6536 (icd)
Enzymes [BR:samb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SAM23877_6536 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH Pr_beta_C
Motif
Other DBs
NCBI-ProteinID: AKZ59581
UniProt: A0AE35
LinkDB All DBs
Position
complement(7048216..7050435)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVIRAYASQAGVPVETRDISLAGRIIALFPEYLTEDQ
RIPDALAELGELAKTPAANIIKLPNISASIPQLKAAIAELQGQGYALPAYPDDPKTDEER
DIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKNHPHRMGAWTAESKTDVATMGEND
FRSTEKSVVIAEDGALRIELVGDDGTTTVLRESVPVKKDEVVDASVLRVAALREFLTAQV
ARAKAEGILYSVHLKATMMKVSDPIIFGHVVRAFFPKTFAQYGETLAKAGLTPNDGLGGI
YKGLESLPEGAEIKASFDAELAEGPELAMVDSDKGISNLHVPSDVIIDASMPAMIRTSGH
MWGPDGQEHDALAVIPDSSYAGVYQAVIDDCRANGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPTTGTVRLVDADGNAVLEQAVSAGDIFRACQTKDAPIRDWVKLAVTRARATGD
PAVFWLDEGRAHDANLIAKVKAYLPEHDTEGLDIRILSPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSLEQYAEVTGNTRAKVLADALDRATATFLNEDKSPTRRVGGIDNRGSHFF
LSLYWAQELARQTDDADLAKAFAPLAETLSANEQKIVEELNAVQGEPAEIGGYYQPDPAK
AAEIMRPSATWNEALASLA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacactgacgaggccccggccctggcgacgtat
tcgttcctgccggtgatccgggcgtacgcctcgcaggcgggtgtccccgtcgagacccgg
gacatctcgctggccggccggatcatcgccctgttcccggagtacctgaccgaggaccag
cgcatcccggacgccctcgcggaactcggcgagctggccaagacgcccgcggccaacatc
atcaagctgccgaacatctcggcgtccatcccgcagctcaaggccgcgatcgccgagctc
cagggccagggctacgcgctgccggcctacccggacgacccgaagaccgacgaggagcgc
gacatccgcgcccgctacgacaaggtcaagggctccgcggtcaacccggtcctgcgcgag
ggcaactccgaccgccgtgccccggcctcggtgaagaactacgccaagaaccacccgcac
cgcatgggcgcctggaccgccgagtccaagaccgacgtggcgaccatgggcgagaacgac
ttccgctccaccgagaagtccgtggtgatcgccgaggacggcgcgctgcggatcgagctg
gtcggcgacgacggcaccaccacggtgctgcgcgagtcggtgccggtgaagaaggacgag
gtcgtcgacgcctcggtgctgcgcgttgccgcgctgcgcgagttcctcacggcgcaggtc
gcccgcgccaaggccgagggcatcctgtactcggtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtggtccgcgccttcttcccgaagaccttcgcg
cagtacggtgagacgctcgccaaggccggcctcaccccgaacgacggtctgggcggcatc
tacaagggcctggagtccctgcccgagggcgccgagatcaaggcctccttcgacgccgag
ctcgccgagggcccggagctggcgatggtcgactccgacaagggcatcagcaacctgcac
gtgccctccgacgtcatcatcgacgcctccatgccggccatgatccgcacctccggccac
atgtggggcccggacggccaggagcacgacgcgctcgccgtcatcccggactcgtcctac
gccggcgtgtaccaggccgtcatcgacgactgccgcgccaacggcgcctacgacccctcc
accatgggctcggtaccgaacgtcggcctcatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatcccgaccaccggcacggtccgcctggtcgacgccgacggc
aacgccgtcctggagcaggcggtctccgccggcgacatcttccgcgcctgccagaccaag
gacgccccgatccgcgactgggtgaagctggccgtcacccgcgcccgcgccaccggcgac
ccggcggtcttctggctggacgagggccgcgcccacgacgccaacctgatcgccaaggtg
aaggcgtacctgccggagcacgacaccgagggcctggacatcaggatcctgtcccccgtg
gaggcgaccaagctgtcggtggagcgcatccgccgcggtgagaacaccatctccgtcacc
ggcaacgtgctgcgcgactacctgaccgacctcttccccatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggcgggcggtggcctcttcgagaccggcgcc
ggcggctccgcgcccaagcacgtgcagcagctcgtgaaagagaactacctgcgctgggac
tccctcggcgagttcttcgccctggtgccgtccctggagcagtacgccgaggtcaccggc
aacacccgggccaaggtcctcgccgacgccctcgaccgcgccacggcgaccttcctcaac
gaggacaagtccccgacccggcgcgtcggcggcatcgacaaccgcggcagccacttcttc
ctgtccctgtactgggcgcaggagctggccaggcagaccgacgacgcggacctggccaag
gccttcgccccgctcgccgagacgctgtccgcgaacgagcagaagatcgtcgaggagctg
aacgccgtccagggcgagccggccgagatcggcggctactaccagcccgacccggccaag
gccgccgagatcatgcgtccgtcggccacctggaacgaggcgctggcgtccctcgcctga

DBGET integrated database retrieval system