KEGG   Sinorhizobium americanum: SAMCFNEI73_Ch1461Help
Entry
SAMCFNEI73_Ch1461 CDS       T04621                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
same  Sinorhizobium americanum
Brite
Translation factors [BR:same03012]
 Eukaryotic Type
  Elongation factors
   SAMCFNEI73_Ch1461
 Prokaryotic Type
   SAMCFNEI73_Ch1461
Mitochondrial biogenesis [BR:same03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SAMCFNEI73_Ch1461
Exosome [BR:same04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SAMCFNEI73_Ch1461
  Exosomal proteins of breast cancer cells
   SAMCFNEI73_Ch1461
  Exosomal proteins of colorectal cancer cells
   SAMCFNEI73_Ch1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: APG90764
UniProt: A0A1L3LL06
LinkDB All DBs
Position
1478997..1480172
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYEFPGDDIPIIKGSALAALEDSDKK
IGEDAIRELMTAVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEI
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDRNGVERGQVLCKPGSVKPHR
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaattcgagcgcaacaagccgcacgtcaacatcggcacgattggccac
gttgaccatggcaagacgtcgctgactgcagcgatcaccaagtacttcggcgaattcaag
gcgtatgaccagatcgacgcggcgccggaagagaaggcgcgtggcatcaccatttcgacg
gcacacgtcgaatacgagacgccggcccgccactatgcgcacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtt
gtgtcggctgccgacggcccgatgccgcagacccgcgaacacatcctgctcgcccgccag
gtcggcgttccggcgatcgtggtgttcctgaacaaggtcgaccaggttgacgacgccgag
cttctcgagctcgtcgagctggaagtgcgcgaactcctgtcgtcctacgaattcccgggc
gacgacattccgatcatcaagggttcggcgctcgccgctctggaagattcggacaagaag
atcggcgaagacgcgatccgcgaactgatgaccgcggtcgacgcctacatcccgacgccg
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgcggcacggtcgtgaccggccgcgtcgagcgcggcatcgtcaaggtcggtgaggaaatc
gagatcgtcggcatccgtccgacgacgaagacgacctgcacgggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggcgcgctgctgcgcggtgtcgac
cgcaacggcgtcgagcgcggtcaggttctgtgcaagccgggttcggtcaagccgcaccgc
aagttcaaggccgaagcctacatcctgacgaaggaagaaggcggccgtcatacgccgttc
ttcaccaactaccgcccgcagttctacttccgcacgacggacgtgacgggcatcgtgacg
ctgccggaaggcaccgaaatggtgatgccgggcgacaacgttacggtcgacgtcgaactg
atcgtgccgatcgccatggaagagaagctgcgcttcgctatccgtgaaggcggccgcacc
gtcggcgccggcatcgtcgcctccatcgtcgagtaa

DBGET integrated database retrieval system