KEGG   Staphylococcus aureus MS4: NI36_10400Help
Entry
NI36_10400        CDS       T04800                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sams  Staphylococcus aureus MS4
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sams00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NI36_10400
Enzymes [BR:sams01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     NI36_10400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(2055795..2056394)
Genome map
AA seq 199 aa AA seqDB search
MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
NAIEAINISKASEIMTHDLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDF
RGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYE
PRCRAHHIVAPSDNNKEEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaacttaccattccggttggatagaatgtattacaggtagtatgtttagcggt
aaatccgaagaacttataagacgtttaagaaggggcatatacgctaaacaaaaagtcgtt
gtatttaaaccggcgattgatgatcgatatcataaagaaaaagtggtctctcataatggt
aatgccattgaagcgattaatatttctaaagcaagtgaaattatgacgcacgacttaact
aatgttgatgttataggaatagacgaagtgcaattttttgacgatgaaattgtaagtata
gtagaaaaactatcagcagatggacaccgtgttattgttgctggattagatatggatttt
aggggcgaaccgttcgaaccaatgcctaaattgatggctgtcagtgaacaagtaacgaaa
cttcaagcagtttgtgctgtttgtggttcttcatctagtagaacgcaacgattaataaat
ggtaaaccagctaaaatcgatgatccgattatcttagtgggtgccaatgaaagttatgag
ccacgttgtcgtgcgcaccatatcgtagcacctagtgataataataaggaggaattataa

DBGET integrated database retrieval system