KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs1728Help
Entry
gbs1728           CDS       T00104                                 

Definition
(GenBank) unknown
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
san00473  D-Alanine metabolism
san01100  Metabolic pathways
san01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:san00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    gbs1728
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    gbs1728
Enzymes [BR:san01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     gbs1728
Peptidoglycan biosynthesis and degradation proteins [BR:san01011]
 Precursor biosynthesis
  Racemase
   gbs1728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TIG
Motif
Other DBs
NCBI-ProteinID: CAD47387
UniProt: Q8E3M9
LinkDB All DBs
Position
complement(1785156..1786256)
Genome map
AA seq 366 aa AA seqDB search
MISSYHRPTRALIDLEAIANNVKSVQEHIPSDKKTFAVVKANAYGHGAVEVSKYIESIVD
GFCVSNLDEAIELRQAGIVKMILVLGVVMPEQVILAKNENITLTVASLEWLRLCQTSAVD
LSGLEVHIKVDSGMGRIGVRQLDEGNKLISELGESGASVKGIFTHFATADEADNCKFNQQ
LTFFKDFISGLDNCPDLVHASNSATSLWHSETIFNAVRLGVVMYGLNPSGTDLDLPYPIN
PALSLESELVHVKQLHDGSQVGYGATYQVTGDEFVGTVPIGYADGWTRDMQGFSVIVNGE
LCEIIGRVSMDQMTIRLPQKYTIGTKVTLIGQQGSCNITTTDVAQKRQTINYEVLCLLSD
RIPRYY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagttatcatagaccaaccagagccttgatagatttagaggcgattgcaaat
aacgttaaatctgtacaagagcacattccaagtgataaaaaaacatttgctgtagttaag
gctaatgcttatgggcatggtgctgttgaagtttcaaaatacattgagtctattgtagat
ggtttttgcgtatccaatttagatgaggctattgagctacgtcaagcaggaattgtaaaa
atgatattggtattaggtgttgttatgcctgagcaggttatactagccaaaaatgaaaat
attactctaacagttgctagcttggagtggttacgtttatgtcagacatcagcagtagat
ttatctggtctagaagtacatatcaaagttgatagtggaatgggacgtataggtgttcgc
cagttagatgaaggaaataagctaatttctgaattgggggaaagtggtgcctctgtcaag
gggattttcacccattttgcaacagctgatgaagccgataactgtaaattcaatcaacaa
cttactttttttaaagactttatttcaggattagataattgtccggaccttgttcatgct
agtaattctgctacaagcctttggcatagtgagacaatttttaatgccgttagattgggt
gttgttatgtacggcttaaatccaagtggaactgatttagacttaccttaccctataaac
cctgctttaagtttagagtctgagctagtacatgttaaacaactacacgatggttctcaa
gttggctatggcgcaacctatcaagttactggagacgaatttgttggaacagtaccgatt
ggctacgctgatggatggacacgagatatgcaaggattttcagttatagtaaatggagaa
ctttgtgaaattattgggcgtgtctcgatggatcaaatgactatccgtttacctcaaaaa
tatactatcggaactaaagtaaccttgattggtcaacaaggtagttgtaacattacaact
acggacgtcgctcaaaaaagacagacgattaattatgaagtactttgtcttttaagcgat
cgtattccgagatattattaa

DBGET integrated database retrieval system