Sorex araneus (European shrew): 101558495 Help Entry 101558495         CDS       T07854                                  Name (RefSeq) glutathione S-transferase A2   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism sara  Sorex araneus (European shrew) Pathway sara00480   Glutathione metabolism sara00980   Metabolism of xenobiotics by cytochrome P450 sara00982   Drug metabolism - cytochrome P450 sara00983   Drug metabolism - other enzymes sara01100   Metabolic pathways sara01524   Platinum drug resistance sara05200   Pathways in cancer sara05204   Chemical carcinogenesis - DNA adducts sara05207   Chemical carcinogenesis - receptor activation sara05208   Chemical carcinogenesis - reactive oxygen species sara05225   Hepatocellular carcinoma sara05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:sara00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     101558495   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     101558495    00982 Drug metabolism - cytochrome P450     101558495    00983 Drug metabolism - other enzymes     101558495  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101558495    05204 Chemical carcinogenesis - DNA adducts     101558495    05207 Chemical carcinogenesis - receptor activation     101558495    05208 Chemical carcinogenesis - reactive oxygen species     101558495   09162 Cancer: specific types    05225 Hepatocellular carcinoma     101558495   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101558495   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     101558495  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:sara02000]     101558495 Enzymes [BR:sara01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      101558495 Transporters [BR:sara02000]  Other transporters   Pores ion channels [TC:1]    101558495 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  101558495 NCBI-ProteinID:  XP_004605915 LinkDB All DBs Position Unknown AA seq 223 aa AA seqDB search MAGKPKLHYFNGRGRMECIRWLLAAAGVEFDEKFIESPGDLQKLKTDGSLIFEQVPMVEI DGMKLVQTRAILNYIANKYNLYGKDAKERALIDMYSEGVFDLGELILTLVLCPPGEKAAK IAMIKEKAANRYLPAFEKVLKSHGQDYMVGNALSRLDIHLVELLYYVEELEPSMLANFPL LKAFKSRISSLPNVKKFLQPGSQRKPPITEEQLEEAKKIFGIK NT seq 672 nt NT seq  +upstreamnt  +downstreamnt atggcagggaagcccaagcttcactacttcaatggacgaggccgaatggagtgtatccgg tggctcctggctgcagctggagtggagtttgacgagaagtttatcgaaagtccaggagac ttgcaaaagttaaaaactgatgggagtttgatattcgagcaagtgccaatggttgaaatt gatggaatgaagttggtacagaccagagccattctcaactacattgccaacaaatacaac ctctatgggaaagacgcaaaggagagagccctgattgatatgtacagcgaaggtgtgttt gacctgggtgaactgattttgactttggtattatgtccacctggcgagaaagctgccaag atcgccatgatcaaagagaaagccgccaatcgttacttgcctgcgtttgagaaggtgctg aagagccacggacaagactacatggtgggcaacgccctgagcaggctggacatccacctg gtggaactgctctactacgtggaggagctggagcccagcatgctggccaacttccctctg ctgaaggccttcaaaagcaggatcagcagccttcccaacgtgaagaagttcctgcagcca ggcagccagaggaagccccccatcaccgaggagcagctagaggaagcaaagaagattttc ggtattaaataa

DBGET integrated database retrieval system