KEGG   Salmo salar (Atlantic salmon): 100196443Help
Entry
100196443         CDS       T04363                                 

Gene name
gsto1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:sasa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100196443 (gsto1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100196443 (gsto1)
   00982 Drug metabolism - cytochrome P450
    100196443 (gsto1)
   00983 Drug metabolism - other enzymes
    100196443 (gsto1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100196443 (gsto1)
   05204 Chemical carcinogenesis
    100196443 (gsto1)
   05225 Hepatocellular carcinoma
    100196443 (gsto1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100196443 (gsto1)
  Drug resistance
   01524 Platinum drug resistance
    100196443 (gsto1)
Enzymes [BR:sasa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100196443 (gsto1)
Transporters [BR:sasa02000]
 Other Transporters
  Pores ion channels [TC:1]
   100196443 (gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
ssa01
AA seq 239 aa AA seqDB search
MASEKCFAKGSSAPGLVAKGQIRLYSMRFCPFAHRTRLVLHAKGIKHDTVNINLKDKPEW
FLKKNPLGLVPTLETSSGQVIYESPITCDYLDEVYTDKKLLPADPFQKAQQKMMLENFSK
ITPYFYKIPLGKKNGEDISVLEAELKEKFVKLNEDLVNKKSKFFGGNAITMIDYMMWPWF
ERLEIFELKHCLDGTPELKKWTEHMSEDQTVKATMFPTETYKAFYKTYADGKPNYDYGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgaaaaatgttttgctaaaggaagctctgctcctggcctggttgccaaaggt
caaatcaggctctacagtatgaggttctgcccctttgcccacagaaccagactagtgctt
catgccaaggggatcaagcatgacactgtcaacattaatttgaaagacaaacctgagtgg
ttccttaagaagaaccctcttggcctggttccgacattggagacttcgagtggtcaggtg
atctacgagtcaccaatcacctgtgactacctggatgaggtttacacagacaaaaagctg
ctcccagctgatccttttcagaaggcccaacagaaaatgatgctggagaatttctccaag
ataacaccatatttctacaagataccattggggaaaaaaaatggagaagacatttcagtg
ctggaagcggagctgaaagagaaatttgtgaaattgaatgaagatctagtcaataagaag
tccaagttctttggtggaaatgcaatcacgatgatcgattacatgatgtggccgtggttt
gagaggctggagatctttgagttgaagcactgtctggatggtacccctgaactgaagaag
tggacagagcatatgtccgaggatcaaactgtcaaagccaccatgttccccactgagacc
tacaaggcattttacaagacctacgcagatgggaaacccaattatgactatggcctgtag

DBGET integrated database retrieval system