KEGG   Salmo salar (Atlantic salmon): 106578314Help
Entry
106578314         CDS       T04363                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     106578314
Peptidases [BR:sasa01002]
 Metallo Peptidases
  Family M2
   106578314
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106578314
CD molecules [BR:sasa04090]
 Proteins
  106578314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
ssa19
AA seq 1291 aa AA seqDB search
MARMARMLWAAVVLVLPLLGLCQFVLPPEWVPEDYPATEVGAESFVTAYNTTAELVTYQN
QEAGWTYQTNITAHNSNKKVESDGLKQAFTEAWGKKAKETFSDMLVATFNDTLQRRIKKI
NILGAANLPAGERHEYNIILSKMSEIYSTAKVCPKPDECWSLEPELTEIMANSRSYKTLL
YAWEGWHNASGVPLKAEYPKFVELSNKAYKADGFDDTGAYWRSWYESQTFEGDLEAIYKQ
IQPLYQNLHAFVRRKLYNHYGPKYINLKGPIPAHLLGNMWAQTWNNIYGMMIPFSSKPNV
DVTDEMMAQNWNATHMFRVAEEFFTSLGLIKMPQEFWDKSMLEKPENREVVCHASAWDFY
NRKDFRIKQCTTVNMQQLFTVHHEMGHVEYYLQYKELPYSFRRGANPGFHEAIGDVMSLS
VSTPKHLASIGLLPNATNDNESDINYLLKMALEKMAFLPFGYLIDQWRWSVFSGRTPPER
YNADWWHLRTKYQGICPPTKRTEEHMDAGAKYHIPGNTPYIRYFVSFILQFQFHKKLCQA
ANQSGPLHTCDIYQSKEAGKILETVLKSGESKPWTQVLQEAIGTNKMDASALMEYFGPII
TWLEEQNAAMNETLGWPDFNWVPPVPEGYPEDIDKIADEVQAKKFLEDYNSTAEGVWNAY
TEASWAYNTDINEENKQNMLQKNLDMSIHTLTYGKEARKYDTTDFQDGSVKRILKKLSDI
ERAGLPDEELKEYNNLLANMETKYSVAQVCRANGTCHPLDPDLQQIMAESRDYNELLFAW
QGWRNASGRELRQDYKRYVQLANKAATLNGHSDNGAFWRSLYETPTFEEDLEHLWKELEP
LYLNVHAYVRRSLYKKYGGKHINVRGPIPAHLLGNMWAQTWSGIMDLAIPYPDATQVDAT
PAMIAKGWNATRMFQESDNFFTSLGLLPMPPEFWAKSMLEKPKDGRNVVCHASAWDFYNR
KDFRIKQCTVITMDDLITVHHEMGHVQYFLQYKDQPISFREGANPGFHEAIGDVLALSVA
TPKHLKEIGLLDVVEDNAESTINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRISEEEYN
KEWWNMRMKYQGLCPPVARTEHDFDPGAKFHIPANVPYVRYFVSFIIQFQFHQALCNAAG
HVGPLHECDIYRSKAAGKLLGDVMKVGFSKPWPETMAMITGKPIMSAKPLVEYFKPLTDW
LEAENNKNDEVRGWPEYDWKPPSDRSETPPPAPDEGKVDFLGMSLDGAGAAAGQWVLLVL
GLVLLVATILLGYKYKKSKRRNLSSSELELK
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atggccagaatggccagaatgctttgggcagcggtggtgctggtactgccactcttggga
ctctgtcaatttgtcctgccacccgagtgggtgccagaggactaccctgccacagaggtc
ggggctgaaagctttgtcactgcctacaataccaccgccgagcttgtcacctaccaaaac
caagaggcaggctggacataccagaccaacattacggcccacaactccaacaaaaaggtg
gaatctgatgggttaaagcaggccttcaccgaagcctgggggaagaaggccaaagaaacc
ttctctgatatgctggtggccacctttaatgatactctgcagaggcgtatcaagaagatc
aacattctgggagcggctaacttacctgcaggagaaagacatgagtacaacatcatacta
agcaagatgtctgaaatatactctactgccaaagtgtgtccaaagccagatgaatgctgg
tctcttgagccagagttgacagagatcatggccaactcacggagctacaagacactgctg
tacgcttgggagggttggcacaatgcatcgggtgtgccactcaaggcagagtatccaaag
tttgtggagcttagcaacaaggcctataaagctgatggttttgatgacacgggagcatac
tggcgttcgtggtatgagtcacagactttcgagggtgacctggaggctatttacaaacag
atacagccgctttaccagaatcttcacgcctttgtgcgccgcaagctctacaaccactac
ggcccaaaatacatcaatcttaaaggacctatccctgctcatctgctaggaaacatgtgg
gcgcaaacctggaacaacatctatggcatgatgatccccttctccagcaaacccaatgtg
gacgtgacagatgaaatgatggctcaaaactggaatgctactcatatgttccgggtggct
gaggagttcttcacctccctgggcctcatcaaaatgccccaagagttctgggacaagtct
atgttggagaagccagaaaatcgggaggtggtgtgccacgcatctgcctgggacttctac
aatagaaaggacttcaggatcaaacagtgcaccacagtcaacatgcagcagcttttcaca
gtgcaccacgagatgggccatgttgaatactatttgcagtacaaggaactgccttatagc
ttccgccgcggggctaacccaggtttccatgaggcaattggtgacgtcatgtccctctct
gtgtccacgcctaagcatctggccagcatcggcctattgcccaatgcgaccaatgacaac
gagagcgacatcaactacctgctgaagatggctctggagaagatggcctttcttcccttc
ggctatctcattgaccagtggaggtggagtgtgtttagtgggcgcacccccccagagcgc
tacaacgcagactggtggcacctcaggacaaaataccagggtatctgtcctcccaccaaa
cgcacagaggagcacatggatgctggagcaaaataccacattccaggaaacaccccatac
atcagatactttgtgagcttcattctgcagttccagttccacaagaagctatgtcaggca
gccaatcagagtggacccctgcacacatgtgacatctaccagtccaaggaggcgggaaag
attttagagacggtccttaaatccggagaatcaaagccctggacacaggtgctccaggaa
gccatcggaacaaacaagatggatgccagtgccctgatggaatactttggtcccatcatc
acatggctggaggaacagaatgcagcgatgaatgagaccctgggctggccagactttaac
tgggttccacccgtaccagagggctaccccgaggatattgacaagattgcagatgaggtg
caggctaagaagttcctggaagattacaacagcactgcggagggggtctggaatgcctac
actgaagcatcgtgggcctacaacactgacatcaatgaggagaacaagcagaacatgcta
caaaagaacttggacatgtctatccacacactgacctacggaaaagaggcccgcaaatat
gacaccacagactttcaggatggttctgtgaagcgtatcctgaagaaactcagtgacatc
gaaagagcaggacttcccgacgaggaactgaaagagtacaacaatctgctggcgaacatg
gaaaccaagtacagtgtggctcaggtgtgcagagctaatgggacttgccatccactggac
ccagacctccagcagattatggctgagtccagagactataatgagctgttatttgcctgg
cagggctggagaaacgcctctggcagagaactgcgacaggactacaagagatatgttcaa
ctggccaacaaagctgccactcttaatggacactctgataacggggcattctggcgctcc
ctgtacgagacccctaccttcgaagaggacctggagcatctgtggaaggagctggagccc
ctctatctcaacgtgcatgcctacgtgcgcaggtctctctacaaaaagtatgggggcaaa
cacatcaatgtgagagggcccatccctgcccatcttctaggtaacatgtgggcgcagacc
tggtctggcatcatggacttggccattccctaccccgatgccacacaagtagacgccaca
ccagccatgatagccaagggctggaatgccaccaggatgttccaagagtcagacaacttc
ttcacttctctggggctgctgcccatgcctccagagttctgggccaagtccatgctggag
aaacccaaggatggacgcaatgtggtgtgtcatgcctccgcctgggacttctacaaccgc
aaagacttcaggatcaaacagtgcaccgtgataaccatggatgacctcatcaccgttcac
catgagatgggtcatgtgcagtacttcctgcagtacaaggaccagcccatctccttccgt
gaaggcgccaatccaggtttccacgaggccatcggtgatgtgttggccctgtctgtcgcg
actcccaagcatctaaaggagattggtttactggatgtggtggaggacaacgcagagagt
acaatcaattacctcatgagcatcgccctggacaaaattgccttcctgcccttcggctac
ctgatggaccagtggaggtggaaagtgtttgacggacgcatctctgaggaggagtacaac
aaggaatggtggaatatgagaatgaagtaccagggcttgtgtccacctgtggcccgcact
gagcacgactttgacccaggtgcgaagttccacatccctgctaatgtgccctatgtcagg
tactttgtgagcttcatcatacagttccagttccatcaggctctgtgtaatgccgccggg
catgtaggccctctccacgaatgtgatatctaccgctccaaagcggcagggaaacttcta
ggtgacgtgatgaaagtgggtttcagtaagccctggcctgaaacgatggccatgatcact
ggaaagcccatcatgtctgccaagccactggtagagtacttcaaacccctcactgactgg
ctggaagcagagaacaacaagaacgatgaggtcagaggctggcctgaatacgactggaaa
ccaccaagtgacaggtcagaaacgccccccccagccccagacgagggtaaagtggacttc
cttgggatgagtctggacggtgcaggagctgcagcaggtcagtgggtcctactggtcctg
ggtctggtgcttctagtggccaccatcctcctgggctacaagtacaagaaatcaaaacgg
agaaatttgtcctcatctgagctggagctgaagtga

DBGET integrated database retrieval system