KEGG   Streptomyces autolyticus: BV401_26535Help
Entry
BV401_26535       CDS       T04980                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00564  Glycerophospholipid metabolism
sauo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sauo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BV401_26535
Enzymes [BR:sauo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BV401_26535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: AQA13455
UniProt: A0A1P8XZ68
LinkDB All DBs
Position
6488736..6490442
Genome map
AA seq 568 aa AA seqDB search
MRTPALGPAERGEALARMADRELDVLVVGGGVVGAGTALDAATRGLETGLVESRDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLGRIAPHLVKPVPFLYPLQHRVWERFY
AGSGVALYDAMSLSSGHGRGLPGHRHLSRGRALLVAPCLKKDALVGALQYYDAQMDDARY
VATLVRTAAKYGAQVTNRARVVGFLREGERVVGARVHDLEQGGEFEVRARQVVNATGVWT
DETQALIGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNEVLAVPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDRRVGPCVTEEIPLVGAVGYKAL
WNARERIGKQAGLHVARIEHLLNRYGSAAQEVLDLIADDPSLGKPLAGAEDYLRAEVSYA
ASHEGARHLDDVLTRRTRISIETFDRGTRCAREVAGLMAPVLGWGDDQLDREVQHYEKRV
EAERESQRQPDDLTADAARLGAPDIIPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgagaacaccggcactgggaccggccgagcgcggcgaggcgctggcccggatggcggac
cgtgagctcgatgtgctggtcgtgggcggcggagtggtcggcgcgggcaccgcgctcgac
gccgcgacacggggcctggagacgggcctggtcgagtcgcgggactgggcctccgggacc
tccagccggtccagcaagctgatccacggcggactgcgctatctggagatgctcgacttc
gcactggtgcgcgaggcactgaaggagcgcgggctgctgctggggcggatcgcaccgcat
ctggtcaagccggtgccgttcctgtatccgctccagcaccgggtctgggagcggttctac
gccggatcgggcgtcgcgctctacgacgccatgtcgctctcctccgggcacggccgcgga
ctgcccggccaccgccatctgagccgggggcgggcgctgctggtcgccccctgcctcaag
aaggacgcgctggtcggggccttgcagtactacgacgcccagatggacgacgcgcgctat
gtcgccacgctcgtacgcacggcggcgaaatacggcgcacaggtgaccaaccgcgcgcgg
gtggtcggcttcctgcgggagggcgagcgtgtggtcggcgcccgggtgcacgacctggag
cagggcggcgagttcgaggtccgcgcccggcaggtggtcaacgccaccggggtgtggacc
gatgagacgcaggcgctgatcggggagcgcgggcagttccacgtccgcgcctccaagggc
atccatctggtcgtccccaaggaccgcatccactccacgaccgggctgatcctgcgcacc
gagaagagcgtgctgttcgtgatcccctggggcaggcactggatcatcggcaccacggac
accgactgggacctggacaaggcccatccggccgcctcgagcgccgatatcgactatctg
ctggagcatgtcaacgaggtcctcgcggtgccgctgacccgcgacgacgtggagggcgtc
tacgccgggctgcgcccgctgctggccggggagtcggacgccaccagcaagctctcgcgc
gagcacacggtcgcccatccggtgccgggcctggtggtggtcgcgggcggcaagtacacc
acgtaccgggtgatggccaaggacgccgtggacgaggcggtgcacggcctcgaccgccgg
gtcgggccctgtgtcaccgaggagatcccgctggtcggcgccgtcggctacaaggcgctg
tggaacgcccgggagcgcatcggcaagcaggccggactgcatgtggcgcggatcgagcat
ctgctcaaccgctacggctcggcggcccaggaggtgctggacctgatcgcggacgacccg
tcgctggggaagccgctcgccggggcggaggactatctgcgcgccgaggtctcctacgcc
gcctcgcacgagggggcccgccatctggacgatgtcctcacccgccgcacccgcatctcg
atcgagaccttcgaccgcggtacgcgctgcgcccgcgaggtggccgggctgatggcgccc
gtgctgggctggggcgatgatcagctcgaccgggaggtccagcactacgagaagcgggtg
gaggccgagcgcgagtcccagcgccagccggacgatctgaccgcggacgcggcccggctg
ggcgcgcccgacatcatcccgctctag

DBGET integrated database retrieval system