KEGG   Sulfobacillus acidophilus TPY: TPY_1155Help
Entry
TPY_1155          CDS       T01576                                 

Definition
(GenBank) aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TPY_1155
   00650 Butanoate metabolism
    TPY_1155
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TPY_1155
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TPY_1155
Enzymes [BR:say01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     TPY_1155
Amino acid related enzymes [BR:say01007]
 Aminotransferase (transaminase)
  Class III
   TPY_1155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1078040..1079365
Genome map
AA seq 441 aa AA seqDB search
MANIKDRQKRYLVPGVTTYYEKPLVLVKGDGRRVTDATGRTYLDFFGGILTVSVGHAHPA
IAAAVTDQVNQLVHTSTLYITEPMVDLAEKLAEITPGDLEQSFFTTSGTEANETAVAMAQ
LATGHQDVLALRHSYSGRSQAAMGLTGQSAWKLGGAGMALPIRHTQNAYCYRCPFGKTPD
RCGLECARDAEAFIRTATSGRLAALIAEPIQGVGGFITPPPAFFQELVPIVRKFGGLFID
DEVQTGFGRTGKRFGIEHYGVVPDIMTFAKGLANGLPIGATVTTAAIGARYTGPTISTFG
GNPLSMRAALATLNVIETENLTENARVTGLLLREGLEELSDRYPAIGDVRGLGLMQGLEW
VRHDKTPAPDLAAEFLEATGELGLLVGKGGLYGNVIRIAPPLTVTVSEVREALELMNQAT
ALVYAHHPELQDIPSTRIHYV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttggccaatatcaaagaccggcaaaaacggtatttggtgccgggtgtcaccacctactat
gaaaaacctttggtgcttgtcaaaggagacggccgtcgggtgacggatgcgacgggtcgg
acctatttagatttttttggcgggattttaacggtatccgtgggtcacgcccatcccgcg
attgctgcggcggtaacggatcaggtcaatcaattggtgcatacgtcgacgctttatatt
accgaaccgatggtggacttagccgaaaagttggccgagatcacaccgggcgacctcgaa
cagagtttctttaccaccagcggcaccgaagctaacgaaacggcggtggccatggcacag
ttggctaccggccatcaagacgtgttggctttgcggcacagctactccggtcgctcccag
gcagccatggggttaaccggccaatcggcctggaaattaggcggagccgggatggcgctt
cctattcggcatacgcagaacgcctattgctaccggtgtccctttggcaaaaccccggac
cgttgtggcttagagtgtgctcgggatgccgaagcctttatccggacggcgacctcgggc
cggttggccgcgttaattgcggaacccattcaaggggttggcggattcattaccccgccg
ccggcattttttcaagaattggttccgattgtgcgaaaatttggcggcctttttatcgac
gacgaagtacagaccggatttggtcggacgggcaaacgctttgggattgagcactacggt
gtcgtcccggatattatgacgtttgccaaggggctggctaacggcttgccgattggcgcc
acggtgacaaccgccgccattggcgcccgttataccgggccgaccatttccacctttggc
ggcaatccgctgtcgatgcgagcggcgttagcgacgttgaacgtcatcgagaccgaaaac
ttgacggaaaacgcccgggttaccggtcttttgcttcgtgaagggctcgaagagctctcc
gatcggtatccggccatcggggatgtgcgaggactggggttaatgcaagggttggaatgg
gtccgacacgataaaaccccggcgccggatctcgcggcggaatttttggaagccaccggc
gaattgggccttttagtgggtaaagggggactctacggaaacgttatccgcattgcccca
ccgctcaccgttaccgtcagtgaagtgcgggaggccctcgaactgatgaatcaagcaacg
gcattggtgtacgctcaccacccggagcttcaagatattccttcgacccgtattcattac
gtttaa

DBGET integrated database retrieval system