KEGG   Sulfobacillus acidophilus TPY: TPY_2810Help
Entry
TPY_2810          CDS       T01576                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
say  Sulfobacillus acidophilus TPY
Brite
Enzymes [BR:say01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TPY_2810 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2599212..2599763)
Genome map
AA seq 183 aa AA seqDB search
MNGISKEEIDQHYGILYKGYVNKLNEIRQKMETVDYAAANQSYSDLRALKTEEVFCLNGS
KLHEWYFDNLGGKGGEAHGRIRELIERDFGSYEKFVTEFKATGLAVRGWVVLAYDLDDEK
LHIYGQDAHNVGVPWGAYPLLILDVYEHAYGIDYGVKRAPYIEAFMNNLDWDEVNQRLAK
YHI
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcattagcaaagaggaaatcgatcagcattatggcattttgtacaaaggctat
gtcaacaagcttaacgagatccggcaaaaaatggagacggtggactatgccgcagccaac
cagtcgtatagcgacttgcgggctttaaagacggaagaggtattttgcctcaacgggtcc
aagctccatgaatggtattttgacaacctggggggcaagggtggcgaagcccacgggcgc
attcgggaactcattgagcgcgatttcgggtcctacgagaaatttgttaccgaattcaaa
gcgacgggtctcgcggtgcggggctgggttgtgctggcctatgacttggatgacgagaaa
cttcacatttatggccaagacgcccacaacgtcggagtgccttggggggcctatccgctt
ttaattttggatgtctatgagcatgcctatggcattgactatggcgtcaaacgggctccc
tatatcgaggccttcatgaacaaccttgactgggacgaagtcaaccaacggttagcgaaa
taccacatctaa

DBGET integrated database retrieval system