KEGG   Shewanella amazonensis: Sama_1087Help
Entry
Sama_1087         CDS       T00445                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
saz  Shewanella amazonensis
Brite
Enzymes [BR:saz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Sama_1087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ABL99294
JGI: Sama1087
UniProt: A1S4I8
LinkDB All DBs
Position
complement(1314986..1315654)
Genome map
AA seq 222 aa AA seqDB search
MIELYTAATPNGHKISIALEELGLEYRVHALDLMTLEQKKPEFLAINPNGRIPAIVDTDN
DDFAVFESGAILLYLAEKTGKLLPTEPKARSEVIQWLMFQMGGVGPMMGQANVFYRYFPE
KIPAAIERYQKEGRRLFEVMNTQLEKHAYLAGDEYSVADIATYPWVRIYDWSGVDISGLD
ALQHWLERITARPAVAKGLAVPPPSEKSAEERAKDIAKMVTR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattgagctttataccgccgcgacccccaacggccataaaatttccattgcccttgaa
gaattagggctcgagtatcgggtacatgcccttgatctcatgacccttgagcaaaaaaag
cccgagtttctggccattaaccccaatggccgtattccggcaattgtagacacagataac
gacgactttgcggtatttgagtcgggtgccatcttgttatatctggccgagaaaaccggc
aagctgctgccgaccgagcccaaggcacgctctgaggttatccagtggctgatgttccag
atggggggcgttggccccatgatgggtcaggcgaacgtgttttaccgctactttcccgaa
aaaattccggccgccattgagcgttatcaaaaggaaggacggcgcctgttcgaggtgatg
aatacccagcttgaaaagcatgcgtatctcgccggagacgagtacagcgtcgccgatatc
gccacctacccctgggtacgtatctatgactggagcggcgtggatatcagtgggttggat
gcgctgcagcactggctcgagcgcatcactgcccggcccgccgtggccaagggccttgct
gtgccgccaccaagtgagaaatccgccgaagagcgtgccaaagacatcgccaaaatggtc
acccgctga

DBGET integrated database retrieval system