KEGG   Shewanella amazonensis: Sama_2059Help
Entry
Sama_2059         CDS       T00445                                 

Definition
(GenBank) Isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
saz  Shewanella amazonensis
Pathway
saz00020  Citrate cycle (TCA cycle)
saz00480  Glutathione metabolism
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz01130  Biosynthesis of antibiotics
saz01200  Carbon metabolism
saz01210  2-Oxocarboxylic acid metabolism
saz01230  Biosynthesis of amino acids
Module
saz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sama_2059
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sama_2059
Enzymes [BR:saz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Sama_2059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF2312
Motif
Other DBs
NCBI-ProteinID: ABM00265
JGI: Sama2059
UniProt: A1S7A8
LinkDB All DBs
Position
complement(2493959..2496184)
Genome map
AA seq 741 aa AA seqDB search
MKDNSPTIIYTETDEAPALATLSLLPILQTFAEPAGVKIETRDISLSGRVIATFPEKLTD
AQRIGDHLAELGELATKPEANIIKLPNISASIPQLKACIKELQAQGYDIPNYPEEPKTDE
EKSIKARYDKIKGSAVNPVLREGNSDRRAPLSVKNYARKNPHSMGKWASDSKSHVSHMEA
GDFYGSEQSVTLADADSVSIVHTSKAGVETVLKSGLKLQAGEIIDSAVMSKNALVAFFER
EIEAAKAEDVLLSLHLKATMMKVSDPIMFGHAVKVFFKPLFAKHAETFERLGVDVNNGFG
DVVAKIQSLPEAERAAIEADIQAVYAERPAMAMVNSDKGITNLHVPSDIIIDASMPAAIR
SSGQMWGPDGQLKDTKFMIPDRCYAGVYDATINFCKAHGAFDPRTMGTIPNVGLMAQKAE
EYGSHDKTFEIAEDGVVTVVNAAGSVLMSHTVEAGDIFRMCQVKDAPIQDWVKLAVRRAR
LSETPAVFWLDKNRAHDAELIKKVEAYLPQHDTSGLEIHIMSPVEATQFSLARMKDGKDT
ISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVEQVQSENY
LRWDSLGEFLALAASFEHLAQTAGVAKAQVLADTLDTAIGKFLDENKSPARRVGQIDNRG
SHFYLAMYWAQALAAQTADAELAAHFGQLADKLAANEETILAELIGVQGHSVDLGGYYRP
DFAKASAVMRPSATLNGLMSH
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataattccccaacgattatttacactgaaaccgatgaggcgccagcactcgct
accctgtccctgctgcctatccttcagacatttgccgagccagccggcgtgaagatcgaa
acccgcgacatctctctgtccggtcgcgttattgctacttttcctgagaagctgaccgat
gcccagcgcattggcgatcacctggctgaactgggcgaactggccaccaagccagaagcc
aacatcatcaagctgccaaacatctctgcttctatcccacagctcaaagcctgtattaaa
gagctgcaggctcagggttatgacatccctaactatcctgaagagccaaagactgatgaa
gagaagtctatcaaggcccgttacgacaagattaaaggcagtgcagtaaaccctgtactg
cgtgaaggtaactccgaccgccgtgcgccgctgtcagtgaaaaactatgcccgcaagaac
ccacactccatgggcaagtgggcaagcgactccaagtctcacgtatctcatatggaagcc
ggtgatttttacggctctgagcagtctgtgacattggccgatgccgatagcgtcagcata
gtgcacaccagcaaagccggtgtggaaaccgttctgaaatcaggtcttaagctgcaagcc
ggtgaaatcatcgactcagctgtgatgagcaaaaatgccctggttgccttctttgagcgc
gaaatcgaagccgccaaggcagaagatgtgctgctgtcgctgcacctgaaagccaccatg
atgaaggtgtctgaccccatcatgtttggtcacgctgttaaagtgtttttcaagccactg
ttcgccaagcatgccgaaaccttcgaacgtctgggtgtggatgtaaacaacggttttggt
gacgtggttgccaaaatccagtctctgccggaagccgagcgcgccgccatcgaagccgat
atccaggccgtgtacgccgagcgtcctgccatggccatggtgaactctgacaagggcatc
accaacctgcacgtaccaagtgacatcatcatcgatgcctccatgcctgcggctatccgc
tcttcaggccagatgtggggcccggacggccagcttaaagacaccaagtttatgatcccg
gatcgctgctatgccggtgtgtacgatgccaccatcaacttctgtaaagcgcacggcgcc
ttcgatccccgcaccatgggtaccatccctaacgtgggcctgatggcgcagaaagccgaa
gagtacggcagccacgacaaaacctttgaaatcgccgaagacggcgtggtgactgtggtt
aacgcggcgggttctgtgctgatgagccacactgttgaagccggtgacatcttccgtatg
tgtcaggtgaaagacgcgccaatccaggattgggtgaagctcgccgttcgtcgcgcccgc
ttgtctgagactccagcggtgttctggcttgataaaaaccgtgcccacgatgctgagctg
atcaagaaggtggaagcctacctgccacagcacgacacctcaggtctggaaattcacatc
atgtctccggttgaagcaacccagttctcgctggcgcgcatgaaagatggcaaagacacc
atctcagttaccggtaacgtactgcgtgactacctgactgacctgttccccatccttgaa
ctcggtaccagcgccaagatgctgtcgatcgtgcctttgatgaatggcggcggtctgttt
gaaaccggtgccggtggcagcgcgcccaagcacgttgagcaggttcagagcgaaaactac
ctgcgttgggattcactgggtgagttcctggcactggctgcatctttcgaacacctggcc
caaaccgccggtgttgccaaggcgcaggtgctggccgataccctggatactgctatcggt
aagttcctggacgaaaacaagtcaccagcccgtcgtgtaggtcaaatcgacaaccgtggc
agccacttctacctggccatgtactgggctcaggcactggccgcgcaaactgccgatgcc
gagcttgctgctcacttcggtcagttggctgataagcttgctgccaacgaagaaaccatt
ttggcggagctgattggtgtacagggccacagcgtggatctcggcggttactatcgtcct
gattttgccaaggcaagtgcagtaatgcgcccaagcgcgaccctgaacggcctgatgagc
cactga

DBGET integrated database retrieval system