KEGG   Sphingobium baderi: ATN00_09465Help
Entry
ATN00_09465       CDS       T04194                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbd  Sphingobium baderi
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbd00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ATN00_09465
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ATN00_09465
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ATN00_09465
Enzymes [BR:sbd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ATN00_09465
Peptidoglycan biosynthesis and degradation proteins [BR:sbd01011]
 Precursor biosynthesis
  Amino acid ligase
   ATN00_09465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1901055..1902011
Genome map
AA seq 318 aa AA seqDB search
MSRGPWHVAVLMGGWSAERPVSLSSGEGVAKALESRGHKVTRIDMDRDVALRLAETKPDV
VFNALHGVPGEDGTVQGMMDLMGLTYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGQVV
QSESLFEGDPLPRPYVVKPVNEGSSVGVAIVTEGGNYGSPVGRDVEGPWLHFEELLAEPY
IRGRELTTAVLGEEALLVTELRPKSGFYDFDAKYTDGMTEHVCPANIPDDIAQACKAISL
RAHKLLGCRGASRSDFRWDDSQGIDGLFLLEVNTQPGMTPLSLVPEQAAKLGIDYAELVE
RIVEDALKTGAKMGALHE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggggtccgtggcatgtcgccgtcctgatgggcggatggtcggcggagcgcccc
gtctcgctgtcgagcggggaaggcgtggcgaaggcgctggaatcccgcgggcacaaggtt
acgcggatcgacatggatcgcgacgtcgcgctgcgccttgcggaaacgaagcccgatgtc
gtgttcaacgccctgcacggcgttccgggcgaggacgggacggtgcaaggcatgatggac
ctgatggggctcacctacactcattcgggtctcgccacttcggtcatcgccatcgacaag
caactcaccaaacaggcgctcgtgccgcatggcatccccatgcccggcgggcaggtggta
cagagtgagagcttgttcgagggcgatcccctgccgcgtccctatgtcgtgaagccagtc
aatgaaggcagctccgtcggcgtcgccatcgtgaccgagggcggcaattatggctcgcct
gtcggccgcgatgtggaagggccgtggctgcatttcgaagagttgctggccgaaccctat
atccggggccgggaactgacgaccgcagttctgggtgaagaggcgctgctggtcacggaa
ttgcggcccaagagcggtttctatgatttcgacgccaaatataccgacggcatgactgag
catgtctgccccgccaacatccctgacgacatcgcgcaggcgtgcaaggcgatctcgctg
cgcgcccacaagctgttgggttgcaggggggcgtcacgttccgacttccgctgggacgac
tcgcagggtatcgatggcttgttcctgctggaggtcaatacgcagccgggcatgacgcca
ctcagcctcgtgcctgaacaggcggcgaagctgggcattgattatgcggaactggtcgag
cggatcgtggaggatgcgctgaaaacgggggcgaaaatgggggctttgcatgagtga

DBGET integrated database retrieval system