KEGG   Salmonella bongori NCTC 12419: SBG_1275Help
Entry
SBG_1275          CDS       T01579                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SBG_1275 (gst)
Enzymes [BR:sbg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SBG_1275 (gst)
Transporters [BR:sbg02000]
 Other Transporters
  Pores ion channels [TC:1]
   SBG_1275 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1393942..1394547)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLREIGKDFTLEGVDLAKKRLENGDDYLALNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRQLLAPISSLARYHTLEWLNYIATELHKGFTPLFRPDTPET
LKPAVRAGLEKKLQYVNEALADDQWICGQRFTIADAYLFTVLRWAYGVKLPLDGFTHIES
YMKRAAERPAVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggtgcctgttctcttgcttcccacattacccttcgcgag
attggcaaagacttcacgcttgagggtgtcgatctcgcgaaaaagcgtctggaaaatggc
gatgattaccttgcgctaaacccgaaaggacaggttcctgctctgcttttggatgacggc
acattattgactgaaggggtcgccattatgcagtatcttgcagacagcgttcccgaccgc
cagcttctggcccccataagcagtcttgcgcgttatcatacgctggagtggctaaactat
attgcaacggaactgcataaagggtttacgccgctgtttcgccctgacacacccgaaacg
cttaagcctgccgtccgtgccggactggaaaagaaattacaatacgttaatgaggcgctt
gcagacgatcaatggatttgcggtcaacgttttactatcgcagacgcttatctgtttacc
gttttgcggtgggcgtatggggtaaaactgcctcttgacgggttcacgcatattgagagt
tatatgaagcgcgctgcggaaagaccggctgttgcagccgcgcttaaagcggaaggatta
aattaa

DBGET integrated database retrieval system