KEGG   Salmonella bongori NCTC 12419: SBG_3159Help
Entry
SBG_3159          CDS       T01579                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00250  Alanine, aspartate and glutamate metabolism
sbg00410  beta-Alanine metabolism
sbg00640  Propanoate metabolism
sbg00650  Butanoate metabolism
sbg01100  Metabolic pathways
sbg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SBG_3159
   00650 Butanoate metabolism
    SBG_3159
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SBG_3159
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SBG_3159
Enzymes [BR:sbg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SBG_3159
Amino acid related enzymes [BR:sbg01007]
 Aminotransferase (transaminase)
  Class III
   SBG_3159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF1869
Motif
Other DBs
NCBI-ProteinID: CCC32212
UniProt: A0A0K0HFS1
LinkDB All DBs
Position
complement(3455778..3457043)
Genome map
AA seq 421 aa AA seqDB search
MKSAELNHRRQQATPRGVGVMCDYFVEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
IVAAVEQQLQAFTHTAYQIVPYESYVSLAERINAIAPVDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGVSVD
DALKSLERIFKADIAADQVAAIVLEPIQGEGGFNVAPAAFMQALRLLCDTHGILLIADEV
QTGFARTGKVFAMQHYAVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDIIEEEQLCQRANQLGEHLQEVLNQARASCPAIADVRGLGSMVAVEFND
PQSGEPSAEYTRQVQRKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARVLR
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtgctgaactgaatcatcgtcgccagcaggcgactccccgtggcgtaggtgta
atgtgcgactactttgtagagaaagcggagaacgccacgctgtgggatgtggaaggcaat
gaagtgatcgactttgctgccgggatcgccgtgctgaataccggacatcgccatccgaag
attgtggcggcggtagagcagcagttgcaggcgtttacccataccgcttaccagattgtc
ccttatgagagttacgtctcactggcagaacgcattaatgctatcgcccctgtcgacggg
ccagcaaaaaccgcgttttttaccaccggtgccgaagcggttgaaaatgctgtaaaaatt
gcccgcgcctacactggacgcccgggacttattacctttggcggtggttttcatggccgt
acattcatgaccatggcgctgaccggcaaagtggctccctacaaaattggctttggcccg
ttcccgggctcggtttaccacgcggtctatccgaacgctgcccacggggtttccgttgac
gatgcgctcaagagcctggaacgtatatttaaagcggatatcgccgccgatcaggtcgcc
gcgattgtgctggagcccattcagggcgaaggcggtttcaacgtcgcgcccgccgctttt
atgcaggcgttgcgcctgttgtgcgatacccacggcattttgctgattgccgacgaagtg
caaaccggctttgcccgtaccggcaaggtgtttgcgatgcagcactatgcggtgaaaccc
gatctgatgacgatggcgaaaagcctggcaggtggcttcccgctatcgggtgttgtgggg
cgtgccgaagtaatggatgcccctgcgccgggtggattaggcggaacttatgccggtaat
ccgctggcagtagccgccgcgcatgcggtgctggatattattgaagaagaacagctctgc
cagcgggctaatcaactgggtgaacatctgcaagaggtgctgaatcaggcgcgcgcaagc
tgtccggcgattgcggatgtgcgtggtctggggtcgatggtggcagtagagtttaacgat
ccgcaaagcggcgagccgtctgcggaatatacccgccaggtacagcgcaaagctcaggaa
aacggcctgctgctgttgagctgcggtgtctacggtaacgttatccgtttcctttatccc
ttaacaatcccggatgcccagttcagcaaagcgctggatattctggcccgtgtgctgcgc
gcctga

DBGET integrated database retrieval system