KEGG   Sorghum bicolor (sorghum): 8069872Help
Entry
8069872           CDS       T01086                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2-like
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    8069872
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    8069872
Enzymes [BR:sbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     8069872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7
AA seq 964 aa AA seqDB search
MAGKLEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGEDLRELVQECY
EIAAEYERKHDSEKLDELGNMLTSLDPGDSIVTAKAFSHMLNLANLAEEVQIAYRRRIKL
KKGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDALKSQTVDLVLTAHPTQSVRRSL
LQKHSRIRNCLVQLCSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMS
YFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMAANLYCSQIENLMFELSMWRCNDELRAQADELHRSSKKDAKHYIEFWKKVPP
SEPYRVILGDLRDKLYNTRERARQLLSSGYSDIPEESTVTNVEQFLEPLELCYRSLCACG
DRVIADGSLLDFLRQVSTFGLCLVRLDIRQESDRHTDVLDAITTYLGIGSYREWSEERRQ
EWLLSELNGKRPLFGPDLPTTDEIADVLDTFRVIAELPADNFGAYIISMATAPSDVLAVE
LLQRECHVKTPLRVVPLFEKLADLEGAPAALARLFSVDWYRERINGKQEVMIGYSDSGKD
AGRLSAAWQLYKAQEELIKVAKKFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGS
LRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALLDEMAVVATKE
YRSIVFQEPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFH
LPVWLGFGAAFKHILEKDIRNLHMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDKL
LVSSELWPLGEKLRANYEETKRLLLQVAGHKDLLEGDLYLKQRLRLRDAYITTLNVCQAY
TMKRIRDPDYHVTLRPHLSKEIMDWNKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAGM
QNTG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaagttggagaagatggcgtcgatcgacgcgcagctgcggatgctggcgccg
gcgaagctgtcggaggacgacaagctggtggagtacgacgccctcctcctcgaccgcttc
ctcgacatcctccaggacctccacggcgaggatctccgtgagctggtacaagagtgctat
gagatagctgctgagtatgaaaggaagcatgactcagaaaagcttgatgaacttggcaac
atgttgaccagcttggatcctggtgattcgattgtaactgcgaaagcattctcacatatg
cttaacttggccaacttggctgaggaagtccagattgcttatcggaggagaatcaagctc
aagaagggggactttgctgatgagaactcagcactgactgaatctgatattgaggaaact
tttaagcggcttgtagttgaccttaagaagtcaccagctgaagtttttgatgctctgaag
agtcagactgttgacctggttttgactgcacatccaacacagtcagtaaggagatcactg
ctacagaagcactcacggataaggaattgtttagttcaactgtgctctaaggacatcaca
ccagatgacaaacaggagcttgatgaggctctccagagggagatccaggcagccttcaga
actgatgagatcagaagaacacagcctactccacaagatgaaatgcgggctggtatgagt
tacttccatgaaacaatatggaaaggtgttccaaagtttttacgccgcgtggatactgcc
ttgaagaacattggaattgatgagcgtgtgccgtataatgcccctctcattcagttctct
tcttggatgggaggagatcgtgatggaaatccaagagtgacaccagaggttacaagggat
gtctgtttgcttgccagaatgatggctgcaaatttgtattgctcacagattgagaatctc
atgttcgagttgtctatgtggcgatgcaatgatgagcttcgggcacaagcagatgagtta
catcgctcatcaaagaaagatgcaaagcactatatagagttctggaaaaaggttcctccg
agtgagccatatcgggttatacttggcgatttgagagacaagctttacaatacacgtgag
cgggcacgccagttgttatccagtggatattctgacattcccgaagaatctactgtcaca
aacgttgagcagttcttagagcctttggagctatgctacaggtctctctgtgcttgtggt
gaccgtgtaattgctgatggaagccttcttgatttcttgcgccaagtttctacctttgga
ctgtgccttgtgaggcttgacataaggcaggaatctgataggcacactgatgtccttgat
gctattaccacctacttaggaataggttcataccgtgagtggtctgaggaacgccgtcag
gagtggctcttgtctgaactcaatgggaagcgtccattgtttggtccagaccttcccact
actgatgagattgctgatgtcctagacacattccgtgtgatagctgaacttcctgcggac
aactttggagcatacattatttctatggcaacagctccatctgatgttcttgctgttgag
cttctccagcgtgaatgtcatgtgaagacaccacttagagttgtcccactatttgagaag
ttggctgatcttgaaggtgccccagctgcactggccagactcttctcagtggattggtat
agagaaaggattaatggcaaacaggaggtcatgattggctactcagactcaggtaaggat
gctggtcgcctctcagcagcttggcagctgtacaaggctcaggaggagcttatcaaagtc
gctaagaaatttggggtgaaattgacgatgttccatgggcgaggtggtactgttggaaga
ggtggaggccccactcatcttgccattttgtctcagccaccggatacaatccatggatcc
ctcagggtcactgttcagggggaagtcattgaacagtcctttggtgaggagcacctgtgt
ttcaggacactgcagcgtttcacggctgctactcttgagcatggcatgcatccaccaatt
tccccaaaacctgaatggcgtgctctgcttgatgagatggctgtagtggcaacaaaggaa
tatcggtccattgtcttccaagaaccacgctttgtggagtatttccgccttgcaacacct
gaaatggagtatggaaggatgaacatagggagcagaccatccaagagaaaaccaagtggt
gggattgagtctctacgtgccattccatggatctttgcatggacacagacacgcttccac
ctccctgtctggctgggttttggggctgcctttaagcacatcctggaaaaggacattagg
aacctccacatgcttcaggagatgtacaatgagtggccattcttcagggtgacaattgat
ctagttgagatggtgttcgccaagggtgacccaggcatcgctgccttgtacgataaactc
cttgtttcttcagagctctggcctcttggggagaagctgagggcaaattatgaagagacc
aaacgtcttctccttcaggttgctggacacaaggatcttcttgaaggggatttatacctg
aagcagcgtctccgcctccgtgatgcgtacatcaccacactgaatgtctgccaagcctac
acgatgaagcgcatccgtgacccagattaccatgtcacactgcggccccacctgtccaag
gaaatcatggactggaacaagcctgctgcagagctcgtcaagctgaacccgaccagtgag
tatgctccggggctggaggacaccctcatcctgaccatgaagggcattgctgctgggatg
cagaacactggttag

DBGET integrated database retrieval system