Sorghum bicolor (sorghum): 8083705 Help Entry 8083705           CDS       T01086                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism sbi  Sorghum bicolor (sorghum) Pathway sbi04016   MAPK signaling pathway - plant sbi04070   Phosphatidylinositol signaling system sbi04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:sbi00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     8083705    04070 Phosphatidylinositol signaling system     8083705  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     8083705  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sbi01009]     8083705   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sbi04131]     8083705    03036 Chromosome and associated proteins [BR:sbi03036]     8083705   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sbi04147]     8083705 Protein phosphatases and associated proteins [BR:sbi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      8083705 Membrane trafficking [BR:sbi04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     8083705 Chromosome and associated proteins [BR:sbi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      8083705 Exosome [BR:sbi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    8083705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ DUF6279 PA_Ig-like Fe_hyd_lg_C SurA_N_3 MecA_N RTX_C Motif Other DBs NCBI-GeneID:  8083705 NCBI-ProteinID:  XP_002467948 UniProt:  A0A921UN46 C5X1U2 LinkDB All DBs Position 1:complement(67667869..67671676) Genome browser AA seq 149 aa AA seqDB search MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggaccagctcaccgacgaccagatcgccgagttcaaggaggccttcagcctcttc gacaaggacggcgatggttgcatcacaaccaaggagcttggaactgtcatgcgttcactg ggtcaaaacccaaccgaggctgagcttcaggacatgatcaatgaggtcgatgccgatggc aatggcaccattgactttcctgagttcctcaacctcatggcccgcaagatgaaggacacc gactccgaggaggagctcaaggaggcgttcagggtgttcgacaaggaccagaacggcttc atctctgcagcggagctccgccatgtgatgaccaaccttggcgagaagctgaccgacgag gaggtcgatgagatgatccgcgaggctgacgtcgatggcgatggccagatcaactacgag gagttcgtgaaggtgatgatggccaagtga

DBGET integrated database retrieval system