KEGG   Shewanella baltica OS195: Sbal195_2170Help
Entry
Sbal195_2170      CDS       T00622                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sbn  Shewanella baltica OS195
Brite
Enzymes [BR:sbn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Sbal195_2170
Peptidases [BR:sbn01002]
 Metallo Peptidases
  Family M2
   Sbal195_2170
Exosome [BR:sbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal195_2170
CD molecules [BR:sbn04090]
 Proteins
  Sbal195_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2577506..2579371)
Genome map
AA seq 621 aa AA seqDB search
MVISLNRRSKIALTVALTLGLTACNDAQSKTDKPASTEAAVINTARDKAQAIAFINDAEA
KMAELSIESNRAEWIYSNFITDDTAALSAAVGEKVSAASVKFATKAAKYANVQLDPVNAR
KLNILRSALVLPAPLDPAKNAELAQISSELNGLYGKGKYCFADGKCMTQPELSSLMAESR
DPATLLEAWKGWREIAKPMRPLFQREVELANEGAKDLGYANLSELWRSQYDMKPDDFSQE
LDRLWGQVKPLYESLHCYVRGELNKEYGDNIAPTTGPIPAHLLGNMWAQQWGNVYDLVAP
DNADPGYDVTELLAKNGYDEHKMVKQAEGFFTSLGFAPLPENFWARSLFVQPKDRDVVCH
ASAWDLDNLDDIRIKMCIQKTAEDFSVIHHELGHNFYQRAYKQQPFLFKNSANDGFHEAI
GDTIALSITPSYLKQIGLLDEVPDASKDIGLLLKQALDKIAFLPFGLMIDQWRWKVFSGE
ITPAQYNQAWWDLREKYQGVKAPTKRSEADFDPGAKYHVPGNVPYTRYFLAHILQFQFHQ
ALCETAGDKGPVHRCSIYGNQAAGEKLNKMLELGLSKPWPEALKEVTGKETMDAKAVLDY
FAPLKTWLDEQNTVANRQCGW
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggttatttcattgaatcgtcgcagtaaaatcgccctcacagtggccttaacgctggga
ttaacggcctgtaatgatgcacaaagcaaaaccgacaagcctgctagcactgaagcggct
gtcatcaataccgcccgagataaagcacaagccattgcttttattaacgatgctgaagcc
aaaatggctgaattatcgattgaatctaatcgcgccgagtggatttacagcaactttatt
accgatgataccgcggctctgtctgccgcagtcggtgaaaaggttagcgcagcgtcggta
aaatttgcaacaaaggcggctaagtacgccaatgtgcaactcgatcccgttaatgcccgt
aagctcaatatcctacgcagcgcgttagtgttacccgccccgctcgaccctgcgaaaaat
gccgagcttgcgcaaattagctcagaattaaatggcttatacggcaaaggaaaatactgt
tttgccgacggtaagtgtatgacccagcctgagctatccagcttgatggccgaatcacgg
gatcccgccacgttgctggaagcgtggaaaggctggcgtgaaattgccaaacccatgcgt
cccttgtttcaacgtgaagtggaactggccaatgaaggcgcgaaggatcttggttatgca
aacctgtctgagctatggcgtagtcaatatgatatgaaacccgatgatttttcacaggaa
ctcgatcgtctttggggccaagtgaaacccctttatgaatcattgcactgttacgtgcgc
ggtgaactcaataaagaatacggcgataacatcgcaccgaccacaggacctatccctgca
catttactcggcaatatgtgggcccagcaatggggaaatgtgtatgatttagtcgcccca
gacaatgccgacccgggttacgatgtcactgagctactggcaaaaaatggctatgacgag
cataaaatggtgaaacaagccgaaggcttcttcacatcactaggatttgcgccattgcca
gaaaatttttgggcacgttctctattcgttcagccaaaggatcgtgatgtggtttgccac
gcctcggcatgggatctcgataatctcgacgatattcgtataaaaatgtgtatccaaaag
accgccgaagactttagcgtgatccaccacgaacttggacataacttctatcaacgcgct
tataagcagcaaccattcctgtttaaaaacagcgccaacgatggtttccatgaagcgatt
ggtgacacgattgcgctgtcgatcaccccaagctacttaaaacagattggcttattagac
gaagtacctgatgcctctaaggacattggcctcttactgaagcaagctttagataaaatc
gccttcttaccctttggtctgatgatagatcagtggcgctggaaagtgtttagcggcgaa
atcacacctgcccaatataaccaagcttggtgggatctcagggaaaaataccaaggcgta
aaagcaccgacgaagcgcagcgaagctgactttgatccgggcgctaaataccatgtgcca
ggtaatgtgccttacacccgctacttcctcgcgcatattctgcaattccagttccatcaa
gcgctgtgtgaaactgcaggcgataaaggtccggttcatagatgcagtatttatggcaat
caagctgcgggagagaaactcaataagatgctcgagttaggtttaagtaagccatggcca
gaagcattgaaagaagtcactggcaaagaaaccatggatgccaaagctgtgctcgattac
ttcgcgccacttaaaacatggttagatgagcaaaataccgtcgcaaatcgccaatgtggt
tggtaa

DBGET integrated database retrieval system