KEGG   Shewanella baltica OS223: Sbal223_4015Help
Entry
Sbal223_4015      CDS       T00803                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sbp  Shewanella baltica OS223
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal223_4015
  Energy metabolism
   00680 Methane metabolism
    Sbal223_4015
Enzymes [BR:sbp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sbal223_4015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4778349..4781018
Genome map
AA seq 889 aa AA seqDB search
MVVTKADNMTDMYASLRSNVSMLGQILGDTMRTHLGDSFLEKVEQIRKLAKDSRRGDQAA
REQMLELLTALPDEELVPFAKAFNQFLNLANLSEQFHTISRNCDELVCVPDPVEQLLGRM
LNGRVDQTKMLDCLKTLDIDLVLTAHPTEISRRTLIQKYAAIVDCLTEQENDQLSDRERQ
QISLRLRQLIAQIWHTNEIRRERPTPVDEARWGLSTIEESLWHAVPDFLRQLNDQVQQRT
GQQLPIDIAPVRFSSWMGGDRDGNPFVTAKVTQEVLDRNRHAAARLFLKDIVLLVGELSM
EEANDELKAYTNNSCEPYRHVLRSIRQRLRDTIDYLNARIEGHNPEVDKSSLIWQESDLK
APLEMLYKSLTDCGMRLIANGLLLDILRRLACFGIHMLRLDIRQDASRHSDVLAELTRYL
GMGDFNHWDETEKQAFLLRELSNRRPLIPSNWQPSADVAEVLNTCRLIAKHPAKALGSYV
ISMAGKPSDVLTVLLLLKETGCSHPMRVVPLFETLSDLNNAAACITDLLDIDWYRGYTKG
MQEVMIGYSDSAKDAGVMAAAWAQYHAQEQLVAVCKQAGVKLTLFHGRGGSIGRGGGPAH
KAILSQPPGSVDGRIRVTEQGEMIRFKFGLPKLAVQSLALYTSAVLEATLLPPPEPKQEW
RDCMQRIAEESVGAYRGIVRDEPDFVAYFRAATPEVELGKLPLGSRPAKRRVDGGIESLR
AIPWIFAWSQNRLMLPAWLGAGEALQAACERGEMGLLQEMEREWPFFSTRISMLEMVYAK
AEPNLARYYETCLVPKDLHHLGETLRQRLDLGIKVVLELTKSDSLMAHTPWNRESVKLRN
PYIDPLNFLQTELLARTRKETTETPASEHVQLALMLTIAGVAAGMRNTG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggttgtaaccaaggcagacaatatgaccgatatgtatgcgtcattaagatcgaacgtg
agtatgttaggacaaatcctcggtgacactatgcgcacccacctcggggactcttttctc
gagaaggttgaacagatccgtaaacttgctaaagattcacgccggggcgatcaagccgct
agagagcaaatgctcgagttactcaccgccctgccagacgaagaattagttccgtttgca
aaggcatttaaccagttcctcaacctagctaatttatctgaacaatttcataccattagc
cgcaactgcgacgaactcgtctgcgtaccagatcccgtggaacagctgctaggccgcatg
ttaaatggccgtgtagaccaaacgaaaatgctcgactgccttaagacactggatatcgat
ctagtgctgacagcgcatcccactgaaatttcccgtcgcaccctgatccaaaagtacgcc
gccattgtcgactgcttaactgaacaagaaaacgaccaattatcagatagagagcgtcag
caaatcagtctgcgcctgcgccaattgatcgcgcaaatctggcacaccaatgagatccgc
cgtgagcgcccaacacctgttgatgaagcccgctggggattatcgaccattgaagagtca
ctttggcatgcggtgccggacttcttaagacagcttaacgaccaagtgcaacaacgcacg
ggtcaacaattaccgattgatatcgcgccagtgcgtttttcaagctggatgggcggcgat
cgcgacggcaacccctttgttaccgcgaaggtcacccaagaggtgctcgatcgcaaccgc
catgccgccgccagattatttctaaaagacatagtcctactggttggcgagctgtcgatg
gaagaagccaatgatgagttaaaggcttacaccaacaacagctgcgagccataccgccac
gtgttgcgatctattcgtcaaagactgcgtgacaccatagattatttaaatgcgcgcatc
gaaggccacaatcctgaagtcgataagtcgagcctgatttggcaagaaagcgatctcaaa
gcgccgctagaaatgctttataagagtttgaccgactgcggtatgcgcttaatcgccaac
ggtttattgctcgatattctccgtcgcctcgcctgttttggcattcacatgctcagactc
gacattcgccaagacgccagccgtcacagcgatgtgctcgcagaattaactcgctatctc
ggcatgggtgatttcaaccattgggatgaaaccgagaaacaagctttcctattacgtgaa
ctcagcaaccgtcgtccactgatcccaagtaactggcaaccgtcagccgatgtggccgaa
gtgcttaatacctgccgtttaattgctaaacatccggctaaagcgctcggatcctatgtg
atttcgatggcgggtaagccatcggatgtcttaacggttttactgttactcaaagaaacg
ggctgttcgcacccaatgcgcgtggtgccactatttgaaaccctaagcgacttaaacaac
gccgcagcctgtattaccgatttactcgacatcgactggtatcgtggttataccaagggc
atgcaagaagtgatgattggctactctgactctgctaaagatgccggcgtaatggcggcg
gcttgggctcagtatcacgctcaagagcagttagtggcggtctgtaaacaagcgggcgtc
aagctcacactattccatggccgcggcggcagcattggtcgcgggggcggtcctgcacac
aaagcgattctatcccaacctccgggatcggtagatggccgtattcgtgtcactgagcaa
ggcgaaatgatccgcttcaagtttggcttgccaaaactcgcggttcaaagcttagccttg
tatacctctgccgtattggaagcaaccctgctaccaccgccagagcctaaacaagaatgg
cgcgattgcatgcaacgtatcgctgaagaatcagtgggggcataccgtggcatagtgcgt
gatgaaccagattttgtggcttatttccgcgcggcaacacccgaagtggaattaggaaaa
ctgccactcggcagccgcccagctaaacgtcgtgtcgatggtgggattgaaagcctacgg
gcaattccatggatttttgcttggtcgcaaaaccgtttgatgttacctgcatggctcggc
gccggtgaagcactacaagccgcctgtgaacgcggtgaaatgggcttattacaagagatg
gaacgggaatggcctttcttcagcactcgtatttcaatgctggaaatggtctacgccaag
gcggaacctaatttagcccgctactacgaaacctgtttagtaccgaaagacttgcatcac
ttaggcgaaaccttgcgccaacgcttagatctgggcattaaagtcgtgcttgaactgaca
aaatcagatagcttaatggcgcatacaccgtggaatcgcgagtcagtaaaactgcgaaat
ccgtatatcgatccattaaacttcttacaaactgagctattagcgcggacacgtaaggaa
acaaccgaaactcccgcgtctgaacatgtgcagctagcgctaatgctgactattgcaggt
gtggcagcgggaatgagaaacactggttaa

DBGET integrated database retrieval system