KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028218Help
Entry
101028218         CDS       T04350                                 

Gene name
TGM2
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
Huntington's disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    101028218 (TGM2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101028218 (TGM2)
Cell adhesion molecules and their ligands [BR:sbq04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     101028218 (TGM2)
   VLA-5
     101028218 (TGM2)
   VLA-9
     101028218 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 687 aa AA seqDB search
MAEELILERCDLELESNGRDHHTADLCREKLVVRRGQPFRLTLHFEGRNYEASVDSLTFS
VVTGPAPSEQAGTKARFPLQDAVEEGGWTATVVDQQDCALSLQLTAPADAPIGLYRLSLE
AATGYQGSSFVLGHFTLLFNAWCPADAVYLDSEDERQEYVLTQQGFIYQGSAKFIKSVPW
NFGQFEDGILDICLMLLDVNPKFVKDAGRDCSRRSSPIYIGRVVSAMVNCNDDQGVLLGR
WDNNYGDGVSPMFWIGSVDILRRWRNHGCQRVKYGQCWVFAAVACTVLRCLGVPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSMHKSVNRSL
VVGMKISTKSVGRDEREDITHTYKYPEGSSEEREAFTKANHLNKLVEKEEAGMAMRIRVG
RSMNMGSDFDVFAHITNNTEEEHACRLLLCARTVSYNGVLGPECGTKDLLNLTLEPFSEK
SIPLRILYEKYCDCLTESNLIKVRGLLVEQATNSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLRNPLTVSLAGCIFTVEGAGLTEEQKTVEIPDPVEPGEEVKVRVDLLPLHVG
RHKLVVNFESDKLKAVKGFRNVIIGPA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggagctgatcttggagaggtgtgatctggagctggaatccaatggccgagac
caccacacggccgacctgtgccgggagaagctggtggtgcgacggggccagcccttccgg
ctgaccctgcactttgagggccgcaactacgaggccagtgtagacagtctcaccttcagc
gtcgtgaccggcccagcacccagcgagcaggccgggaccaaggcccggtttccactgcaa
gacgctgtggaggaggggggctggacggccaccgtggtggaccagcaggactgcgccctc
tcgctgcagctcaccgcccccgccgacgcccccatcggcctgtatcgcctcagcctggag
gccgccaccggctaccagggctccagcttcgtgctgggccacttcaccctgctcttcaac
gcgtggtgcccagcggatgctgtgtacctggactctgaagacgagcggcaggagtacgtc
ctcacccagcagggcttcatctaccagggctcggccaagttcatcaagagtgtaccttgg
aactttgggcagtttgaagatgggatcctggacatctgcctgatgcttttggacgtcaac
cccaagtttgtgaaagacgccggccgcgactgctcccgccgcagcagccccatctacata
ggccgggtggtgagcgccatggtcaattgcaacgatgaccagggtgtgctgctgggacgc
tgggacaacaactacggggacggtgtcagccccatgttctggatcggaagcgtggacatc
ctgcggcgctggaggaaccacggctgccagcgcgtcaagtacggccagtgctgggtcttc
gccgccgtggcctgcacggtgctgcggtgcctgggcgtccccacccgcgtggtgaccaac
tacaactcagcccacgaccagaacagcaaccttctcatcgagtacttccgcaatgagttt
ggagagatccagggtgacaagagcgagatgatctggaacttccactgctgggtggagtca
tggatgaccaggccagacctgcagccggggtacgagggctggcaggccctggacccaacg
ccccaggagaagagcgaagggacatactgctgtggcccagttccagttcgggccatcaag
gagggcgacctgagcaccaagtacgatgcgccctttgtctttgcggaggtgaatgccgac
gtggtggactggatccagcaggacgatgggtccatgcacaagtccgtcaaccgttccctg
gtcgtcgggatgaagatcagcactaagagcgtgggccgtgacgagcgggaggacatcacc
cacacctacaaatacccagaggggtcctcagaggagagggaggccttcacaaaggccaac
cacctgaacaaactggtcgagaaggaggaggcagggatggccatgcggatccgcgtgggc
cggagcatgaacatgggcagcgactttgatgtctttgcccacatcacgaacaacaccgaa
gaggagcacgcctgccgccttctgctctgtgcccgcactgtcagctacaacggggtcttg
gggcctgagtgtggcaccaaggacctgctcaacctcaccctggagcctttctctgagaag
agcattcctcttcgcatcctctatgagaagtactgtgactgcctcacggagtccaacctc
atcaaggtgcggggcctcctggtggagcaagctaccaacagctacctgctggcagagagg
gacctctacctggagaatccagagatcaagatccggatcctcggggagcccaaacagaaa
cgcaagttggtggctgaggtgtccctgcggaacccgctcactgtgtccctggcaggctgc
atcttcactgtggagggggccggcctgaccgaggagcagaagacggtggagatcccagac
cccgtggagccaggggaggaagtcaaggtgagggtggacctgctgccgctccacgtgggc
cgccacaagctggtggtgaacttcgagagcgacaagctgaaggctgtgaagggcttccgg
aatgtgatcattggccctgcctaa

DBGET integrated database retrieval system