KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051872Help
Entry
101051872         CDS       T04350                                 

Gene name
CSAD
Definition
(RefSeq) cysteine sulfinic acid decarboxylase isoform X1
  KO
K01594  
sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
Taurine and hypotaurine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbq00001]
 Metabolism
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    101051872 (CSAD)
Enzymes [BR:sbq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     101051872 (CSAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 558 aa AA seqDB search
MDEGGGDPLGLLCPVGRPEKLAVYRGGQTRVKESSRAIAGCFGGGQKRDWQCPHVRVLRV
RPKILMADSEALSSLAGDPMAVEALLQAVFGIVVDEAIQKGTSASEKVCEWKEPEELKQL
LDLELRSQGESQEQILERCRAVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQ
YTYEIAPVFVLMEEEVLRKLRALVGWSSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRG
LRTLPPLALFTSKECHYSIQKGAAFLGLGTDSVRVVKADERGRMVPEDLERQISMAEAEG
AVPFLVSATCGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLDGIQR
ADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFYDVELDTGDKVVQ
CGRRVDCLKLWLMWKAQGSQGLERRIDQAFALARYLVEEMKKREGFELVMEPEFVNVCFW
FVPPSLRGKQDSPDYHKRLSTVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANPALT
RADIDFLLNELERLGQDL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagggggcggagatcctttggggcttttgtgcccagtgggccggcccgaaaag
ctcgcagtttacagaggcggccagactagggtgaaggaaagctcaagggccatcgctggg
tgcttcggtggcgggcagaaaagggactggcagtgcccacacgtgcgtgttctccgcgtc
cgcccgaagatcctgatggctgactcagaagcactctcctcccttgctggggatcccatg
gctgtggaagccttgctccaggccgtgtttgggattgtggtggatgaggccattcagaaa
ggaaccagtgcctccgagaaggtctgtgagtggaaggagcctgaggagctgaagcagctg
ctggatttggagctgcggagccagggggagtcgcaggaacagatcctggagcgttgccgg
gctgtgattcactacagtgtcaagaccggtcaccctcggttcttcaaccagctcttctca
gggttggatccccatgctctggctgggcgcattatcaccgagagcctcaacaccagccag
tacacgtatgaaatcgcccccgtatttgtgctcatggaagaggaggtgctaaggaaactt
cgggccctggtgggctggagctctggggatggaatcttctgccctggtggctccatctcc
aacatgtatgctgtaaatctggcccgttatcagcgctacccggattgcaagcagaggggc
ctccgcacactgccacccctggccctattcacatcgaaggagtgtcactactccatccag
aagggagctgcatttctgggacttggcactgacagtgtccgagtggtcaaggctgatgag
agaggaagaatggtccccgaggatctggagaggcagatcagtatggccgaggctgagggt
gctgtgccgttcctggtcagtgccacctgtggcaccactgtgctaggggcctttgacccc
ctggaggcaattgctgatgtgtgccagcgtcatgggctatggctgcatgtggatgctgcc
tggggtgggagcgtcctgctgtcacagacacacaggcatctcctggatgggatccagagg
gctgactctgtggcctggaatccccacaagctcctcgcagcaggcctgcaatgctctgca
cttctcctccaggacacctcgaacctgctcaagcgctgccatgggtcccaggccagctac
cttttccagcaggacaagttctacgatgtggaactggacaccggagacaaggtggtgcag
tgtggccgccgcgtggactgtctgaagctgtggctcatgtggaaggcacagggcagtcaa
gggctggagcggcgcattgaccaggccttcgcccttgcccggtacctggtggaggaaatg
aagaagcgggaagggtttgagctagtcatggagcctgagtttgtcaatgtgtgtttctgg
ttcgtgccccccagcctgcgagggaagcaggatagtccagactaccacaaaaggctgtcg
acggtggcccctgtgctcaaggagcgcatggtgaaggagggctccatgatgattggctac
cagccccacggcacccggggcaacttcttccgtgtggttgtggccaaccctgcgctgacc
cgtgctgatatagacttcctcctcaacgagctggagcggctaggccaggacctgtga

DBGET integrated database retrieval system