KEGG   Shewanella baltica OS117: Sbal117_0820Help
Entry
Sbal117_0820      CDS       T02013                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
sbs  Shewanella baltica OS117
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sbal117_0820
Enzymes [BR:sbs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Sbal117_0820
Transporters [BR:sbs02000]
 Other Transporters
  Pores ion channels [TC:1]
   Sbal117_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
920451..921083
Genome map
AA seq 210 aa AA seqDB search
MITLYGTPRSRALRVAWVLEELGVDWDFSFVDMTKGAHRSAAFLAINPCGKVPVLTDDEL
VLSESAAICLYLAEKYGEGKLLPPAGSNASGLHHQWVSFIITELEQPLWTLGKHKFALPE
EQRHPQIMPCAVWEFDKAAALAEAMLPESDFLLGDDVSVADILLAHTLMWGTLFEQAIPP
KLAAYRDRLSALPSRQSALQKMDAVVAAKG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgatcactttatatggcacaccgcgcagtcgcgcattacgagttgcttgggtgttggaa
gagttgggcgttgattgggatttttcctttgtagatatgactaagggggcgcatcgcagc
gcggcatttttagcgataaatccctgtggtaaagtgcctgtgctaactgatgatgagtta
gtgttatctgaatcagcggcgatttgcctttatctagcagaaaagtatggtgagggtaag
ttgttgccacccgcggggagtaacgcatcgggtttgcaccatcaatgggtgagcttcatc
attactgagcttgagcagccgctttggactttgggtaagcataagtttgctttaccggag
gagcagcgtcatccgcagatcatgccttgtgctgtatgggagtttgataaggcggctgca
ttggccgaagccatgttgcctgaaagtgattttttgctcggtgatgacgtttcggtggcg
gatattttattggcccataccttaatgtggggcacattgtttgaacaagccattccgcct
aaacttgccgcttatcgcgataggttgtctgcgctgccgtcgcgtcaatcggctttgcag
aagatggatgctgtggtggctgctaagggttaa

DBGET integrated database retrieval system