KEGG   Shewanella baltica OS117: Sbal117_2407Help
Entry
Sbal117_2407      CDS       T02013                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00473  D-Alanine metabolism
sbs00550  Peptidoglycan biosynthesis
sbs01100  Metabolic pathways
sbs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sbal117_2407
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal117_2407
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Sbal117_2407
Enzymes [BR:sbs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sbal117_2407
Peptidoglycan biosynthesis and degradation proteins [BR:sbs01011]
 Precursor biosynthesis
  Amino acid ligase
   Sbal117_2407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: AEH14128
LinkDB All DBs
Position
2747675..2748688
Genome map
AA seq 337 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLMSANYFETSLAKSEQFSVLRVELDKFGQYRTAAGDDSEL
TNSREIRFRDESKTPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQFDDAAIEQTQAALAQWGSIFVKAASQGSSVGCYKVDDS
DKVAGVLKDAFGYAPYVIVEKTIKARELEVAVYEYNGEVVATVPGEIICDTNTFYTFDEK
YAKNSKARTDVVAQHVSAEISEQIRAYAIKAFKGMKLRHLSRIDFFLTADNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVINGQLTAKS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagatcaatctacttttgctgtgcggcggcggaagtgccgaacacgatatttca
ttaatgtcggccaactattttgaaacctcactggcaaaatctgagcagttttccgtgttg
cgagtcgagctggataaattcggccagtaccgcactgccgctggtgacgacagtgagctg
accaatagccgcgagattcgcttccgtgatgaaagcaaaacgccatggccagtcgattac
gtcattccttgcattcatggctatcccggcgagactggcgacattcaatcctattttaat
ctgatccaactgccctattttggctgtgaatccgaagcgagcagcaactgcttcaataag
atcaccgctaaaatgtggttctcggccttaggtattcctaatacgccatatattttcctg
aatcagttcgatgatgcggcgattgagcaaacccaagcggcattggcacaatggggatcg
atcttcgttaaagcggcctcgcagggttcctctgttggttgttacaaagtggatgacagc
gataaagttgcaggcgtgcttaaggatgcttttggctatgcaccctatgtgatcgttgaa
aaaaccataaaagcccgcgagttagaagtagcagtatacgagtacaatggtgaagtggtg
gcgacagtgccaggtgaaatcatctgtgataccaacaccttctacaccttcgatgagaaa
tacgccaaaaacagtaaagcgcgcaccgatgtggtcgcacagcatgtttcagctgagatc
agcgaacagatccgtgcctatgcaatcaaggcatttaaaggaatgaagctgcgtcatctg
tcgcgcatcgactttttcttaaccgcggacaatgaaattctattgaatgaaatcaatacc
ttcccaggttctacgccgatttctatgttccctaaaatgctgcaaaatcacggtcatgac
tttactgaatacttgagcctagtgattaacggtcagctaaccgctaaatcttaa

DBGET integrated database retrieval system