KEGG   Shewanella baltica OS678: Sbal678_4247Help
Entry
Sbal678_4247      CDS       T01725                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sbt  Shewanella baltica OS678
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal678_4247
  Energy metabolism
   00680 Methane metabolism
    Sbal678_4247
Enzymes [BR:sbt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sbal678_4247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
4922492..4925161
Genome map
AA seq 889 aa AA seqDB search
MVVTKADNMTDMYASLRSNVSMLGQILGDTMRTHLGDSFLEKVEQIRKLAKDSRRGDQAA
REQMLELLTALPDEELVPFAKAFNQFLNLANLSEQFHTISRNCDELVCVPDPVEQLLGRM
LNGRVDQTKMLDCLKTLDIDLVLTAHPTEISRRTLIQKYAAIVDCLTEQENDQLSDRERQ
QISLRLRQLIAQIWHTNEIRRERPTPVDEARWGLSTIEESLWHAVPDFLRQLNDQVQQRT
GQQLPIDIAPVRFSSWMGGDRDGNPFVTAKVTQEVLDRNRHAAARLFLEDIVLLVGELSM
EEANDELKAYTNNSCEPYRHVLRSIRQRLRDTIDYLNARIEGHNPEVDKSSLIWQESDLK
APLEMLYKSLTDCGMRLIANGLLLDILRRLACFGIHMLRLDIRQDASRHSDVLAELTRYL
GMGDFNHWDETEKQAFLLRELSNRRPLIPSNWQPSADVAEVLNTCRLIAKHPAKALGSYV
ISMAGKPSDVLTVLLLLKETGCSHPMRVVPLFETLSDLNNAAACITDLLDIDWYRGYTKG
MQEVMIGYSDSAKDAGVMAAAWAQYHAQEQLVAVCKQAGVKLTLFHGRGGSIGRGGGPAH
KAILSQPPGSVDGRIRVTEQGEMIRFKFGLPKLAVQSLALYTSAVLEATLLPPPEPKQEW
RDCMQRIAEESVGAYRGIVRDEPDFVAYFRAATPEVELGKLPLGSRPAKRRVDGGIESLR
AIPWIFAWSQNRLMLPAWLGAGEALQAACERREMGLLQEMEREWPFFSTRISMLEMVYAK
AEPNLARYYETCLVPKDLHHLGETLRQRLDLGIKVVLELTKSDSLMAHTPWNRESVKLRN
PYIDPLNFLQTELLARTRKETTETPASEHVQLALMLTIAGVAAGMRNTG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggttgtaaccaaggcagacaatatgaccgatatgtatgcgtcattaagatcgaacgtg
agtatgttaggacaaatcctcggtgacactatgcgcacccacctcggggactcttttctc
gagaaggttgaacagatccgtaaacttgctaaagattcacgccggggcgatcaagctgct
agagagcaaatgctcgagttactcaccgccctgccagacgaagaattagttccgtttgca
aaggcatttaaccagttcctcaacctagctaatttatctgaacaatttcataccattagc
cgcaactgtgacgaactcgtctgcgtgcctgatcccgtggaacaactccttgggcgcatg
ttaaatggccgtgtagaccaaacgaaaatgctcgactgccttaagacactggatatcgat
ctagtgctgacagcgcaccccacagaaatttcccgtcgcaccttgatccaaaagtacgcc
gccattgtcgactgcttaactgaacaagaaaacgaccaattatcagatagagaacgtcag
caaattagtctgcgcctgcgccaattgatcgcgcaaatctggcacaccaatgagatccgc
cgtgagcgcccaacacctgttgatgaagcccgctggggattatcaaccattgaagagtca
ctctggcatgcggtgccagacttcttaagacagcttaacgaccaagtgcagcaacgcacg
ggtcaacaattaccgattgatatcgcgccagtgcgtttttcaagctggatgggcggcgat
cgcgacggcaacccctttgttaccgcgaaggtcacccaagaggtgctcgatcgcaaccgc
catgccgccgccagattatttctagaagacatagtcctattggttggcgagctgtcgatg
gaagaagccaatgatgagttaaaggcttacaccaacaacagctgcgagccataccgccac
gtgttgcgatctattcgtcaaagactgcgtgacaccatcgattatttaaatgcgcgcatc
gaaggccacaatcctgaagtcgataagtcgagcctgatttggcaagaaagcgatctcaaa
gcgccgttagaaatgctttataagagtttgaccgactgcggtatgcgcttaatcgccaac
ggtctattacttgatattctccgtcgtctcgcctgttttggcattcacatgctcagactc
gacattcgccaagacgccagtcgtcacagcgatgtgctcgccgaattaactcgctatctc
ggcatgggtgatttcaaccattgggatgaaaccgagaaacaagctttcctattacgcgaa
ctcagcaaccgtcgtccgctgatcccaagtaactggcagccgtcagccgatgtggccgaa
gtgcttaatacctgtcgtttgatcgctaaacatccagctaaggcacttggatcctatgta
atttcgatggcgggtaagccatcggatgtcttaacggttttactgttactcaaagaaacg
ggctgttcgcacccaatgcgcgtagtgccgctgtttgaaaccctaagcgacttaaacaac
gccgcagcatgtattaccgatttactcgacatcgactggtatcgtggttataccaagggc
atgcaagaagtgatgattggctactctgactctgctaaagatgccggcgtaatggcggcg
gcttgggctcagtatcacgctcaagagcagttagtggctgtctgtaaacaagcgggcgtc
aagctcacactattccatggccgcggcggcagcattggtcgcgggggcggtcctgcacac
aaagcgattctatcccaacctccggggtcggtagatggccgtattcgtgtcactgagcag
ggcgaaatgatccgcttcaagtttggcttgccaaaactcgcggttcaaagcttagccttg
tatacctctgccgtattggaagcgaccctactaccaccgccagaacctaaacaagaatgg
cgcgattgcatgcaacgtatcgctgaagaatccgtgggtgcataccgtggcatagtgcgt
gatgaacctgattttgtggcttatttccgcgcggcaacgccagaggtggaattaggcaaa
ctgccactcggcagccgcccagctaaacgtcgtgtcgatggtgggattgaaagcctacga
gctattccgtggatttttgcttggtcgcaaaaccgtttgatgttacctgcatggcttggc
gccggtgaagcgctacaagccgcctgtgaacgccgtgaaatgggcttattacaagagatg
gaacgggaatggcctttcttcagcactcgcatttcaatgctggaaatggtctacgccaag
gcagaacctaatttggcccgctactatgaaacctgtttagtaccaaaagacttacatcac
ttaggcgaaaccttgcgccaacgcttagatctgggcattaaagtcgtgcttgaactgaca
aaatcagatagcttaatggcgcatacgccgtggaatcgcgagtcagtaaaactgcgaaat
ccgtatatcgatccattaaacttcttacaaactgagctattagcgcggacacgtaaggaa
acaaccgaaactcccgcgtctgaacatgtgcagctagcgctaatgctgactattgcaggt
gtggcagcgggaatgagaaacactggttaa

DBGET integrated database retrieval system