KEGG   Sphaerochaeta globosa: SpiBuddy_2577Help
Entry
SpiBuddy_2577     CDS       T01439                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00473  D-Alanine metabolism
sbu00550  Peptidoglycan biosynthesis
sbu01100  Metabolic pathways
sbu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SpiBuddy_2577
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SpiBuddy_2577
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SpiBuddy_2577
Enzymes [BR:sbu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SpiBuddy_2577
Peptidoglycan biosynthesis and degradation proteins [BR:sbu01011]
 Precursor biosynthesis
  Amino acid ligase
   SpiBuddy_2577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: ADY14388
JGI: SpiBuddy_2577
UniProt: F0RT83
LinkDB All DBs
Position
complement(2796979..2797956)
Genome map
AA seq 325 aa AA seqDB search
MLIGMTYDLKDDYLKEGYAPELVAECDSIVTIDAIDAALQKLGHQTVRIGNVKALVGYLG
EGKRCDLVFNIAEGLFGLLRESVIPALLDAYQIPYVFSDSFVLAICLHKGFTKEVVRKAG
VATADFCVLSSSDDWKQVSLPYPLFLKPVAGGTGIGITASSKVTNPKDLQKVSGAMLAAY
QQPVLVETYLGGREFTVGITGTGDEAQSTGVMEIIIDHSSDGGIYSYKTKQEYETTTRYE
RPDESAWKASEAVALAAWRALGCRDGGRIDVKMDEKGVVHFLEVNPLAGLHPIDSDLPIL
SRMHGLGYDELIARIMHSAQKRLGL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgctgattggaatgacctatgacttgaaggacgactacctcaaagaagggtatgcacct
gaattggttgccgagtgcgatagcatcgtaaccatcgatgctatcgatgcggcactgcag
aaactgggccatcagacggtgcgtatcggcaacgtgaaggctttggtggggtatcttggt
gaaggtaagcgttgcgatctggtgttcaatattgccgaaggtctgttcggcttgttgcgt
gagtcggtgatcccggccctcctggatgcctatcagataccctatgttttctccgattcc
ttcgttctggcgatttgcctgcataaaggattcaccaaggaagtggtgagaaaagccggg
gtggctactgcagacttttgcgtgctgagctcatccgatgactggaagcaagtttcgttg
ccctatcctctcttccttaaaccggttgcagggggtacgggtattgggattaccgcatcc
agcaaggtaacgaaccccaaagatcttcagaaggtttcgggggcaatgcttgctgcgtat
cagcagccggtcttggtcgagacgtatctgggtgggcgtgagttcactgtcggcatcaca
ggaaccggtgatgaggcacagagcaccggggtgatggaaattattattgaccatagcagt
gacggtggcatttattcctacaagaccaagcaggagtacgagaccactacccgctatgag
agacccgatgagtcggcatggaaggcctccgaggctgttgccttggccgcttggcgtgcc
ctcgggtgccgcgacgggggacgtatcgatgtgaaaatggacgagaaaggggtagtgcac
ttcttggaagtgaatcctttggccggcctgcatcccatcgattcagatctcccgatacta
agcaggatgcatggcttgggctatgatgagcttattgcccggatcatgcactctgcacaa
aagaggctcggcttatga

DBGET integrated database retrieval system