KEGG   Salmonella bongori serovar 48 z41 --: N643_18150Help
Entry
N643_18150        CDS       T03249                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sbv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    N643_18150
  Energy metabolism
   00680 Methane metabolism
    N643_18150
Enzymes [BR:sbv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     N643_18150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3854336..3856987)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPDLNDA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMGEINNCLKQLDNTDIADYERHQVMRRLRQ
LIAQSWHTDEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVDATPELL
ARVGEEGASEPYRYLMKNLRARLMATQSWLEARLKGEKLPKPAGLLTQNEQLWEPLYACY
QSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDIRQESTRHTEALGEITRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWEPSNDTREVLETCKVIAEAPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTVSSLSLYTSAILEANLLPPPEPKDGWRHIMDEL
SVISCQTYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVAKELWPLGKELRDLLEEDIKVVLAIANDSHLMADLPWIAESIQLRNVYTDPLN
VLQAELLHRSRLTEAQGKSPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaggtgctggga
gaaaccatcaaagatgcgctgggagagcacattcttgatcgcgtagaaacaatccgtaag
ctgtccaagtcttcacgcgccggcaatgaagccaatcgccaggaactgctcaccacgctg
caaaatttgtcaaacgacgagttgctgccggttgcgcgcgcgtttagtcagttcctgaac
ctggctaacaccgccgagcaataccacagcatttcgccaaaaggtgaagccgccagcaac
ccggaagtaattgcccgcaccctgcgtaaactgaaaaaccaaccggacctcaacgacgca
accatcaaaaaagcggtagagtcgctgtctctggagctggtgctgaccgcacacccgacg
gaaattactcgccgtacgcttattcacaagatgggtgaaatcaacaactgtctgaaacag
cttgataatactgatatcgccgactacgagcgccaccaggtgatgcgccgcctgcgccag
ttgattgcccaatcctggcatacagatgaaatccgcaagcagcgtccaagtccggtagat
gaagccaaatggggcttcgctgtggtagaaaacagcctgtggcagggcgtaccgaactat
ctgcgtgaactgaacgaacagctggaagagaatctcggctacaaactgccagtagatttt
gtgccagtacgttttacctcctggatgggcggcgaccgtgacggcaacccaaacgtgacg
gcggatatcacccgccacgtactcttattaagccgctggaaggccaccgatctgttcctg
aaagatattcaggttctggtatcagaactgtcgatggtcgatgccacgccagaactgctg
gcgcgggtaggcgaagaaggcgcatctgaaccgtatcgctatctgatgaaaaatttgcgc
gcccgcctgatggcgacccagtcctggctggaggcacgtctgaaaggcgagaaactgcct
aaaccggctggtctgttgacgcaaaatgagcagctctgggaaccgctgtacgcctgctac
cagtcgctacaggcctgtggtatgggcattatcgccaacggcgagttgctcgacacatta
cgccgcgtgaagtgtttcggcgtaccgctggtgcgtattgatatccgccaggagagcacc
cgccacaccgaagcgctgggcgaaatcacccgctaccttggtattggtgactacgaaagc
tggtcggaagccgacaagcaggctttcctgatccgcgagctgaattccaaacggccattg
ttgccgcgcaactgggagccgagcaacgatacccgcgaagtgctggaaacctgtaaagtg
attgccgaagcgccgaaaggctcgatcgccgcctacgtgatctcaatggcgaaaacgccc
tccgacgtgctggcagtgcatttgctattaaaagaagcgggcatcgggtttgcgatgcca
gtcgcgccgttgtttgaaacgctggatgacctgaacaacgccgacgacgtgatgacccag
ttgctgaatatcgactggtatcgcggactgattcagggaaaacagatggtgatgatcggc
tactccgactcggcaaaagatgccggggtaatggccgcgtcatgggcgcagtatcaggcg
caggacgcactgatcaaaacctgcgaaaaagccggtattgagctcaccctcttccacggt
cgcggcggttctattggccgtggcggcgcgccagcccacgcggcgttgctctcccaaccg
ccgggcagcctgaaaggcggtttacgcgtgaccgagcagggcgagatgatccgcttcaaa
tatggtctgcctgaagtcaccgtcagcagcctgtcgctctacaccagcgcgatcctggaa
gcaaacctgctgccaccgccggagccaaaagacggctggcgtcatattatggatgagctt
tccgtcatctcctgccaaacctaccgcggctacgtgcgtgaaaataaagactttgtgccc
tactttcgctcggcaacgccggagcaggaactgggtaaattgccgctcggctcacgtccg
gcgaaacgtcgtccaaccggcggcgtcgaatcgctacgcgccattccgtggatcttcgcc
tggacgcagaaccgtctgatgctaccggcctggctgggcgcgggcaccgccctgcaaaaa
gtggtagaagatggcaagcaaagcgaactggaagcgatgtgtcgtgactggccattcttc
tctacgcgtcttgggatgctggaaatggtgttttcaaaagccgacctgtggctggccgag
tattacgatcagcgtctggtagcaaaagaactctggccgctgggtaaagaactacgcgac
ctgctggaagaagacatcaaagtggtgctggcaattgccaacgactcgcacctgatggcc
gacttaccgtggattgcagagtctattcagttaagaaacgtttataccgatccattaaac
gtattgcaggcggagctgctgcatcgttcccgcctgacggaagcgcaaggaaaatcaccc
gatcctcgcgtcgaacaggcgctgatggtcacgattgcgggcgtcgcggctggtatgcgc
aacacgggttaa

DBGET integrated database retrieval system