KEGG   Salmonella bongori N268-08: A464_1446Help
Entry
A464_1446         CDS       T02733                                 

Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sbz  Salmonella bongori N268-08
Brite
Enzymes [BR:sbz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A464_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1442369..1442950)
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEDKSLEEIVRTS
EGGIFNNAAQVWNHTFYWNCLAPNAGGEPAGKLADAIADSFGSFAEFKAQFTDAAIKNFG
SGWTWLVKGADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLEHFWA
LVNWAFVAKNLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgaattacctgcattaccgtatgccaaagatgctctggcaccgcatatttct
gccgagacgctggaatatcactatggcaaacatcatcaaacttacgtgaccaatctcaat
aatttgatcaaaggcacggcgtttgaagacaaatcgctggaagaaatcgttcgtacctct
gaaggcggcatctttaataacgcagcccaggtctggaaccacacgttctactggaactgc
ctggcgccaaacgctggcggcgagccagccggaaaactggctgatgctatcgcggattcc
tttggcagcttcgcggaatttaaagcgcagttcacggatgccgctatcaaaaactttggt
tccggatggacatggctggtaaaaggcgctgatggcaaactggctatcgtctcaacctct
aatgccggtacgccgctgaccacggatgcgactccgctgctaacggttgatgtatgggaa
cacgcgtattacattgactaccgcaacgcccgtccaaactatctggaacatttctgggca
ctggttaattgggcgtttgtcgcgaaaaacctcgccgcataa

DBGET integrated database retrieval system